SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G53420.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G53420.2
Domain Number 1 Region: 9-286
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.41e-40
Family WD40-repeat 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G53420.2   Gene: BRADI1G53420   Transcript: BRADI1G53420.2
Sequence length 301
Comment pep:novel chromosome:Brachy1.0:1:51768814:51771383:1 gene:BRADI1G53420 transcript:BRADI1G53420.2
Sequence
MLSKKIELDHKDMIHDSAIDYYGKRLATASSDYTVKVVSIGGASAPSKLLATLSGHYGPV
WRVAWAHPKYGAILASCSYDGRVIIWKEGTGGHWSQAHVFADHKSSVNSIAWAPYEVGLC
LACACSDGNIYIMTIRADGGWDTATIERAHPVGATAISWAPATALGLLASSGEVVCKLVS
GGFDSVVKVWEFTNGSWNLDSALPSDMHTDCVRDVAWPPVLGLAKSTIASACQDGKVVIW
TRVKDGDKWQGMVMHDFKTPVWRVSWSLTGNILSVAAGESNITLWKEASGGQWEEVLKVE
P
Download sequence
Identical sequences I1H2F5
15368.BRADI1G53420.2 XP_010228200.1.954 XP_014751766.1.954 XP_014751770.1.954 EG:BRADI1G53420.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]