SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G55240.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G55240.1
Domain Number 1 Region: 220-481
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.9e-54
Family Protein kinases, catalytic subunit 0.00033
Further Details:      
 
Domain Number 2 Region: 511-583
Classification Level Classification E-value
Superfamily RING/U-box 6.36e-22
Family U-box 0.0022
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G55240.1
Domain Number - Region: 34-74
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0689
Family Ubiquitin-related 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G55240.1   Gene: BRADI1G55240   Transcript: BRADI1G55240.1
Sequence length 587
Comment pep:novel chromosome:Brachy1.0:1:53648790:53658059:1 gene:BRADI1G55240 transcript:BRADI1G55240.1
Sequence
MPIRRISIKVARDEDLRSYIGRDGQYFDLVDFDKVRAFSVLVDLPIRHLKENLKEVFGTD
VQFQRLWLFCGRQNGTCRPFRALCEDKQSVLNPSTPRNLSREDLLVFLKLYDPEKTQLRY
IGMLFVKASSRPSEILPKLRNLAGFRADEEIMLYEEIQFKPPLQCEAIDIYNTFSGGQIE
HGDIICYQKSPSYSLSQHAYPSVLTFFEHVHCVKDQNAQIILEFSFVNLQQATEDFKDVC
KVGDTEYGRVYKGTIHNTTVAIKMCRSKSLFQQEVYVVRQGRHPNIVTLIGICAEASALV
YEWLPMGNLEDHIVCSTDSPPLSWRIRTQIIGEVCCALLFLHSHKPSALVHGDLRPCNIL
IDANYRSKLCNFGTSTLFLQPGTCPPNLATRLPYMDPEFLTTGELTPLSDVYSLGVIILR
LLTGMPPIAIAKKVSEALESDSLHLLIDKFAGDWPYIQAKQLALLGLSCVEMRRDKRPDL
LTKVWTVIEPLTEKLPIASWRYIQSASRGSYPPAHFICPILKEIMNDPLMASDGFTYEAE
AIRRWLDDGNLRSPMTNLALPNCNLIPNRALRSSIQEHLQQQRQSDS
Download sequence
Identical sequences I1H310
15368.BRADI1G55240.1 EG:BRADI1G55240.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]