SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G58607.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G58607.1
Domain Number 1 Region: 320-395
Classification Level Classification E-value
Superfamily F-box domain 0.0000000262
Family F-box domain 0.014
Further Details:      
 
Domain Number 2 Region: 67-125
Classification Level Classification E-value
Superfamily F-box domain 0.00000824
Family F-box domain 0.0088
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G58607.1
Domain Number - Region: 206-260,423-544
Classification Level Classification E-value
Superfamily Kelch motif 0.0017
Family Kelch motif 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G58607.1   Gene: BRADI1G58607   Transcript: BRADI1G58607.1
Sequence length 586
Comment pep:novel chromosome:Brachy1.0:1:57509009:57524626:1 gene:BRADI1G58607 transcript:BRADI1G58607.1
Sequence
MERRTRSAGSSGGRKKRISWMSSSGRTRETKVLQTSTGDHLSSPRGGFAQVTPDLAASSP
DMAPLSLDLPDELIHEILFRLQPDELALLVWHFILSKSWDRLLSDPAFHHRYRKLRQMAP
TLGFIYSGYSIYTKIATSFVPAMGFCPPSIPNYKLPDFAVSDCRHSHGLGRVFPFQGFVH
MELVVWNPLTGHHTQFNSFNDFFICMGEEVLCPVDGCDHATCHDFHVVCVGINQEESTTT
AIVYSSQTDEWSAPTPGLQLNGYDIETHNVLVGGALYFLLTGSPRPPELGLALTKLFQAR
ADRIPIRREEMSPSHSRHSSELSPDLTDDAVLEILLRFPPDRLERPEYHVRASLVSKAWR
RALSGPAFCRSYRDFHRMPPMLGFFFSDPSYSSSSYRGFVPTTAFRAPITAPTPSSTFER
VVSACHGRVLFHDLHPLYVVVWDPITGDQRRVFFPWPLCLCSAVDYAVLCATVGWDRRGC
QGGLFFVVRMCRESTTAFQARVYSSGDGAWGDTTSVEHPDAASLFTVNHTSVLLGNTVYM
SWGTIITVLCCQKKIVSASDRYTFFAQKIVSALVMEKLSICTPWHV
Download sequence
Identical sequences I1H448
EG:BRADI1G58607.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]