SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G66640.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G66640.1
Domain Number 1 Region: 19-136,237-304
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.37e-37
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 369-424
Classification Level Classification E-value
Superfamily RING/U-box 0.00000013
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G66640.1   Gene: BRADI1G66640   Transcript: BRADI1G66640.1
Sequence length 504
Comment pep:novel chromosome:Brachy1.0:1:65407319:65410429:1 gene:BRADI1G66640 transcript:BRADI1G66640.1
Sequence
MGHGASCGRPSEEVDFFGAAQSGDLARLAAAVRSRPSLLRRTTLFDRLSALHIAAAHGHL
QVVSMALDLCVQPDVVNRHKQTALMLAAMHGRTECVRRLLDAGANILMFDSSHGRTCLHY
AAYYGHSDCLRTILSAARTAPVSQSWLAFFSEPLNPPPFPLIELAFANGVSVVAVEVQGI
RALRQREGRHRGDAAAPRGQAGLAPLRPRPARERRHRVRLQRRIREGKKKKKLRCDIDAR
SSCRFPGSTPLHLAARGGSLDCVRQLLSWGADRLQRDSVGRIPYEVAMKRGHAACAALLN
PASAEPLVWPSPLKFISELEPDAKALLEAALMEANREREKRVLKGTKSLLPSPSHSDDGA
TISEGAAEVCSICFEQACSIEVRDCGHQMCAACTLALCCHTKPNPATQSQQLPTCPFCRG
SISRLAVATKAKAGDDEDDDDDDDVEGEDRLEESPRHRRTRRSMNLSGDGGSSSGSLMGS
IASSIGKMGRRKTDSSEQVVDDKP
Download sequence
Identical sequences I1H6Y9
EG:BRADI1G66640.1 15368.BRADI1G66640.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]