SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G67800.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G67800.1
Domain Number 1 Region: 347-662
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.04e-39
Family WD40-repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 822-1098
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.64e-37
Family WD40-repeat 0.0038
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G67800.1
Domain Number - Region: 83-136
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0475
Family cAMP-binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G67800.1   Gene: BRADI1G67800   Transcript: BRADI1G67800.1
Sequence length 1134
Comment pep:novel chromosome:Brachy1.0:1:66397050:66405445:1 gene:BRADI1G67800 transcript:BRADI1G67800.1
Sequence
MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFYFNMKYFEDEVINGNWDEVERYLGGF
TKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLT
LENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKSSRLRTLINQSLN
WQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGSIPKPGGFPQLGAHGPFQ
PAPTPVAPLAGWMSNPPAVTHPAVSGGAIGFGTPTNPAAMLKHPRTPSTANPAMDYPPGD
SDHLSKRPRPIGLSEEVNLPVNMMPVTYPQNHSYPQEDFHKAVARTLSQGSTPMSMDFHP
IQQTLLLVGTNVGEIGLWDVGSKERLVVRAFKVWEVAKCSMPLQAALVKEPSISVNRIIW
SPDGTLFGVAYSKHIVQIYAYQGGDDIRQHLEIEAHVGGVNDIAFAHPNKQLCIITCGDD
KTIKVWEATSGVKQFTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLGSRVD
YDAPGHWCTTMSYSADGSRLFSCGTSKDGESHLVEWNESEGAVKRTYQGFRKRSMGVVQF
DTTRNRFLAAGDEFVIKIWDMDNTSLLTTIDAEGGLPASPRIRFNKEGTLLAVSTADNGI
KVLANADGVRLLRTLENRSFDASRSASETVTKPLINPLTAAAVASAAAAAAATSSGTAAP
AAITAMNGDSRSLVDVKPRIADESMDKSKVWKLIEIADTTQCRSLKLSDSVRTTKISRLI
YTNSGVAILALASNAVHLLWKWPRNDRNSSGKATASVSPQLWQPPSGILMTNDPHDNSPE
DAVHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIG
MDDSTIQIYNVRIDEVKSKLRGHSKKITGLAFSNVLNVLVSSGADAQICVWNTDGWERQR
SRFLQIPSGRTTSNILDTRVQFHQDQLHCLVVHETQIAIYDASKLEPMKQWPVRENSAPI
THATFSCDSQLIYASFLDATVCIFSASSLRLQCRILPASYLPPNISSSVHPVVVAAHPSE
ANQFALGLTDGTVYVMEPLESERKWGNPPPVENGSTSNLSTPPNGASSSDQPER
Download sequence
Identical sequences I1H7C5
XP_003558327.1.954 15368.BRADI1G67800.1 EG:BRADI1G67800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]