SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G68487.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G68487.1
Domain Number 1 Region: 291-579
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-73
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 12-116
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000188
Family Universal stress protein-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G68487.1   Gene: BRADI1G68487   Transcript: BRADI1G68487.1
Sequence length 652
Comment pep:novel chromosome:Brachy1.0:1:67063237:67067831:1 gene:BRADI1G68487 transcript:BRADI1G68487.1
Sequence
MAGEHGERVGRCILVGLHMDAAGKDLLQWALNQAARSGDRVIAVHIYRKSGDLCKTNTLT
LIRTLDGYLAEYEAICSKKDIVLVGRVTPGSSIQKVLVKEAKLCAAMVVVIGANKKYSFG
GSTCLAKYCAKKLPPTTSVVAIQNGKAIFVRDAPKPPLGAEPKPVLRTLLHPSVGLEPKV
IIPNPNRSARSMDFDAESCGQCAGPPPPLVKSYDAEADAEAGTAPENRLGWPLLRRAPAP
AQPKGEETRKQSVVHWVMSLPRRPSPSASPDLSPPQEGLAADLKRLLGGVPSRCRWFRYE
ELYDSTNHFSPENLVGNGGHSRVYRGSLASGQQVAIKVCKASAVASKDFLREVDIISKLQ
HERIVPLMGVCVQGPKLISVYRYLPRGSLEDNLHGKRSKPALPWEKRYRAAVGVAEALSY
THSGCSRPVIHRDVKSSNILLTDDFEPQLSDFGLAIWAPSNPSSLTHSDVVGTFGYLAPE
YFMYGKVTDKVDVYAFGVVLLELLTGRKPISDGSPKGHESLVMWATPMLKSGDISDLLDP
SLDVKHDEVEVRRMSLAASLCLGRSARLRPRISQILGILRGEEDATGLQQAAAEPDCLVD
DETYPAANVRSHLGLALLDVEDAESISSTEHSNLSPLEEYLRERCSRSSSFD
Download sequence
Identical sequences I1H7K3
XP_003558383.1.954 XP_014752399.1.954 EG:BRADI1G68487.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]