SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G74120.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G74120.1
Domain Number 1 Region: 13-604
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 2.75e-155
Family Prokaryotic type I DNA topoisomerase 0.0000279
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G74120.1
Domain Number - Region: 900-923
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00101
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G74120.1   Gene: BRADI1G74120   Transcript: BRADI1G74120.1
Sequence length 924
Comment pep:novel chromosome:Brachy1.0:1:71402522:71417448:1 gene:BRADI1G74120 transcript:BRADI1G74120.1
Sequence
MHPSGGGGGAIRVLNVAEKPSVAKSVAEILSRRAMQSRPGRSRYNRIFEFNYAIGGQACH
MLVTSVTGHLMELDFDDRYRRWYSCDPVELFHAPVRKAVPQDKLDIKRTLEEEARTCQWL
VLWLDCDREGENIAYEVVEICAGVNHCLNIWRARFSALIDREIHEAVQHLGRPNKLFADA
VDARQEIDLRIGASFTRFQTMLLKDAFVLDVSGEERNMVLSYGPCQFPTLGFIVERFWEI
QAHEPEEFWTINCSHTSDEGTASFGWIRGHLFDYSSAIVIYEMCVQEPMATVQNVRNQEK
LKYPPYPLSTLELQKRASRCCRMSSEHTMKVAEELYQAGFISYPRTETDNFSPNTDLHAI
AHEQVPHPVWGSYAQRLLNPEERLWRNPSNGGHDDKAHPPIHPTKFTAGESNWSQDHHKV
YELVVRHFLACCSQPAVGAETTVEIDIAGEQFNASGRVVLAKNYLDVYRYDSWGGSLLPT
YTIGQQFVPTTLTLDSGVTRPPPLLAEADLLSCMDKAGIGTDATMHEHIKKLLDRCYATK
DANSRFSPTNLGEALVMGYDEMGYELWKPYLRAMMEADMKAVSIGTKSKLEVLEGCLQQM
KACFLDARSNKVKLLDAMGTFFARSNRPLNETQNPMEVVRPCGACNDSEMLLKRKPNGGF
MVGCRSFPQCRNVVWLPGSLSEAAVTEQICPTCVPGPVYKIQFKFNRRDIPPNFDVDHLG
CIGGCDDVLKELIEITRFVNHNQTTTPARGQSQTPSGVRQGAPRQDLHPGFRPAGQFANG
HTPVVNPQGFRSTHTQNSRNASGQVLCTTCGEACISRTANTEANRGRKFYKCQDSGCGFF
AWEDELENVVPRGRGRGGRGGGRQASASAGRRGGTQGRGRRGRGRNADANGMTFVSATGD
TVHGCCFACGDPSHFANACPNRGR
Download sequence
Identical sequences I1H9D9
EG:BRADI1G74120.1 15368.BRADI1G74120.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]