SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G74505.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G74505.1
Domain Number 1 Region: 44-103
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000131
Family F-box domain 0.0026
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G74505.1
Domain Number - Region: 121-136
Classification Level Classification E-value
Superfamily RNI-like 0.0824
Family Rna1p (RanGAP1), N-terminal domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G74505.1   Gene: BRADI1G74505   Transcript: BRADI1G74505.1
Sequence length 260
Comment pep:novel chromosome:Brachy1.0:1:71723942:71725005:1 gene:BRADI1G74505 transcript:BRADI1G74505.1
Sequence
MPVARPHPQTRRQRRRRVKGRTVHVDVFNYYLDYLLPPAAQEAVPDWTELPLDVTLRILR
CLDPAELLGRAARVCRFWRQATRDEPELWRRIDTRACSRDLPLDGFAREAVRRSAGRGEG
CPHLESLDIRSCGNITMDDALQAKCARIKIKTLRMHRSKGTVPDLEDLQSGSSISVCSTC
MMSEYFWKLRREERELEREKNGIADSDDHYDPYYYYLSVLDDAHLEEHGRVLGKSMRSCI
TGRWHRNESTGDLQLFSAIN
Download sequence
Identical sequences I1H9I3
EG:BRADI1G74505.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]