SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G76290.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G76290.1
Domain Number 1 Region: 132-246
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.05e-22
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 342-380
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000149
Family Chromo domain 0.0028
Further Details:      
 
Domain Number 3 Region: 70-134
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000018
Family Chromo domain 0.0014
Further Details:      
 
Domain Number 4 Region: 275-323
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000903
Family Chromo domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G76290.1   Gene: BRADI1G76290   Transcript: BRADI1G76290.1
Sequence length 399
Comment pep:novel chromosome:Brachy1.0:1:72921506:72922894:1 gene:BRADI1G76290 transcript:BRADI1G76290.1
Sequence
MEAVLRHPSLSRLKPPNPNAHRPTSLSTTVPPRPRFPKRRLVAATAVFQDQSNPRTAAKG
GDGEQDEEEEEGYGEVDRIVSSRTVKNPVFADDGGGTAVTTATEYLVEWKDGHEPTWIPA
EAIAADVVAEYETPWWDAAKKADADALRALLSDEAEPLRRDPDAEDAQGRTAAHFAAGMG
SEECLRALAAAGADMGRAERAGGGLTPLHIAAGYGRASGVRALLDLGADPEAPDEKGRTP
LDLAREVLAKTPGAAVERRQALEAAAKEVEKAVYEWGEVEKVVDGRGEGKWREYLVEWSD
GGDREWVKAPWVAEDLVRDFEAGLEYGVAEAVVDRRPAAGAGEDGGKWEYLVKWVDIEEA
TWEPAENVDDELVQEFERRLSGAGTGGGSSPPAETTVAG
Download sequence
Identical sequences I1HA39
XP_003562136.1.954 15368.BRADI1G76290.1 EG:BRADI1G76290.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]