SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G78390.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G78390.1
Domain Number 1 Region: 433-712
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-64
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 720-799
Classification Level Classification E-value
Superfamily RING/U-box 2.65e-21
Family U-box 0.0034
Further Details:      
 
Domain Number 3 Region: 19-147
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000000419
Family Universal stress protein-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G78390.1   Gene: BRADI1G78390   Transcript: BRADI1G78390.1
Sequence length 803
Comment pep:known chromosome:Brachy1.0:1:74399371:74402958:-1 gene:BRADI1G78390 transcript:BRADI1G78390.1
Sequence
MAIQEEGERAGSADAPLTVGLALGGSKSSTYVLQWALAKFASGKDKDENKSAPTFKLIHV
LTPVLTVPTPLGNYPVDKVRPEIADTHAKEVQVQAQEMLLQCRNMCDENKVEVEVLLVKG
NDVGDAISNLVAQYQIQVLVVGNTTSRKSSRNKTSSKICKSVPSSCTTYIVSKDGLSSVY
SPGLGSDTSDSQVHSGEMSPRSDLNDSSGRTLLGLPSLPRSNLASENLKSSSSSKHDGSF
TLYDYLSGSASVYADQDRTITSCTDGESSISSKVQASDKVPTQGSSLQALMLSDKVPTQK
NSLQGLMLSDSKDDVNTELEKLRLELRHIQGTYKLVQDESVDASHQASSVVVELAAMRVE
GKAQLRDIQSRVDKANDEVQEDKAHRCATEEVVTHFKDLVRAEVMQKNRLLIKASKDADQ
KSRLEELFVLRGNLYSTFTWEEIDNATSSFSESHKIGTGSNGTVYKGHLKHLDVAIKILH
SDDSSSTKHFNQELDVLRRIRHPHLLMLLGALPDRGCLVYEYMENGSLADRLQCINGTQP
IPWFHRFCIAWEIVSALVFLHSTKPNPIIHRDLKPENVLLDRNLVSKIGDVGLSTLVPLK
DSSSSGTMYKNTGLAGTLFYIDPEYHRTGQVSVKSDTYALGMVILQLLTARSPIGLPELV
ERAVEDGQLMDVLDGSAGNWPAKEAYDLAHLGLSCLEMRSKDRPDLKNMVAVELERLKNI
AGAASEPVPGPPSHFVCPILKEVMQDPCIAADGHTYERNAILMWLSKHELSPVTKALLPN
KTLVSNHSLLSAISSWRSQGGGL
Download sequence
Identical sequences C3SAC8
EG:BRADI1G78390.1 15368.BRADI1G78390.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]