SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G00627.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G00627.1
Domain Number 1 Region: 2421-2592,2626-2776
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.49e-77
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0027
Further Details:      
 
Domain Number 2 Region: 130-147,355-508,612-751,844-882,940-978,1036-1231
Classification Level Classification E-value
Superfamily ARM repeat 0.0000432
Family Armadillo repeat 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G00627.1   Gene: BRADI2G00627   Transcript: BRADI2G00627.1
Sequence length 2844
Comment pep:novel chromosome:Brachy1.0:2:288618:326874:1 gene:BRADI2G00627 transcript:BRADI2G00627.1
Sequence
MATPRDVEEVVQKLSSDRARTRDEGVKLLGTWLQGDRALTFCRLLARNTHRAKPGHLSSS
ITWPFLVMAVAKCVVVDIAGKKRGAVKSTAAKMLRVAIQCAEDVRLSGHSLLLISVAKQL
FSHIWEVLKDAPSFQLEYSPILRQLLTVKEYRYQMKPRTYSSFVVLYMKKVATGFDANFS
NQASSKEESFRCTLTLHVLLENPPGDYPDNMRQESLFITYTKIQLKLARAISEVLEKLLD
VIIKELDQNVNTGAGLLWCEASRDEKTGSARCFQEELMDLSATVFYLAYKCPPKRTHREK
RLKTEHVSTLIMDGLSKGSLCWSGTICFLVQKYGYLVEKSLLISWFEASCKSLKSALSNS
NATRFQDSLLWLIRSLKEFSATLIVNTRDESHFLPTKGEMSIVEGYWQDIWNSLIHALPL
FSSTALVADSALSLLGGMIMRDQVHTSFVSEDTWDLQTFKHRPSSSALYFIACYFSRIGF
QGDLSNSIFVRKNLLRSTLELIHSKGSSVLNEHNVVMIPEVIFSLCAGFSSSAINSADAS
QLVGECKIFSKGEDWVIKDELGYSVQALSEISIESSTKVMSDKCNRAHLPGHIQQPLLLE
LMEFIKGFVASNEQFEKVDLCTLVYVCSLLCNLIHCALLSRAIEEKSSFLQSVFDYVTNS
IKYIISMVIKKHDELSHGLTSLGSAFETTGSVLSSFQSFLSSPIFRLRRVSNKVSSVLIK
DVTGLLDELLVAFSQLFSRLSSSLNTSDSESTGKILPISSVNLLEDLNHVVGHKSSVLDM
DFDVTDSGEVDSITASVSGSIGISSRPLEWKLELVCVISTFFSVSPPHAWEILYSLVEKE
IDVKVCQAILLNLCQNISASPKSLSSLVHLISNTREKCESSLLGSADCLTHVHALLRTLI
ATRDVGQNTDGKPQACNMVSNENQDTLLDLVTKGTEISITDWFFRIKLIDCISHFIYLFP
DIAQDMTGHLLNMLHDTDYRVRLYLARKIVVPFQIWEGHNELFHDVCSNIGVKMVQFSNK
IAVKSREVLAAGPQSVPVIETVLITLAHLSVHSEEVEVECAFMISAAAAIETSQRELAYA
LFDSVSRTLSYASRNKYLDQLTGPILFRWVACEMSLVSLVEVQEIFGFNSSESKNFIEHI
CSWLLSFLILRGDAADLNWISKILSQPLSAVIKGYFVPIFGLSIAARCGTGPEKDLAETV
LYDSLLQFGEISESERDDLIRKHMVSIVGLLLSVSSTAHQPEFPYFSREILAFSIKTVVD
GFVDTTDDDLADTVVVDKINIFRADRVFKFLLAIHQQVADASHPRHMGHRLCAIEVLIDV
LGHRVVHYSTCFYIICIVGNYIWRQPLQGQCCNILTKLLTAFNASPTTETVSALGMQLQD
LEPLPALDCLKDIHVFHASLSDSYASRDQFLKFVNRAPHLPAELFLLSSSSVANEASSVL
ADFISRAGISDAHQVIFHVPNLTQKHSSQLQSGSTSKDDKLCSDYGISDDILVGLLKLLK
TYLSDDSVEIIDVTSQTLRGILSTSKGVNSLQCLDSLDKSLLMFYNHKFNGMFRRSIFLC
FASCLGVALDGSLEDSDIWQTDGRSYDQWLCTLVSSLICHCDDIILRYHFQLKNITLVIA
IVEKIIFCDSNHLMKSVNLFLDALNVVRSFYVAEKTRDCPSNTPKVGRSARSKSRSPAAT
PSSSWKKVYWLSVDYLVAARAANRCSCDFATLMYVELWCEEQFNKLALGPPDFSQDESVS
PLLYVLFCCVMSKVVIIYVSFSFQLPAHMGLLVAAFTHINEPDSIYGITLANEITSQIIR
YEHEGDWSSALEYYDLLVRSTPKENLGNFAGTVLAGPSAVFSKAEEKNWKMHKGLMRSLQ
KTGCSHVLDFYSQGLTNQKTCLQQDSEFIDIQYEAAWRAGNWDFSFFIPYSSQPSSRSRN
YCLFNENLHSCLRALQSGDFEQFHGKLSHSKMDLVLALSNASKESTKYIHSTVLKLQMLD
HLTMVWDLRWKIYHNETPKSYVGTDEFSPIPAVPTRNQLEFLNKEWNFILCQTERNLDLF
EPFLAFRRTLLKILGCEEHLIDHLFQSASALRKGLRFSLAAASLYELKELCCHRDQQTMA
NTYFLSKLEEAKLLRAQGQHDMAIGLGKYILQNHTDKKDITDVYRLVGKWLAETRSSNSR
TIIEDYLKHSVDLTEFHKSPDKKYMSRQCRTYFHLAHYTDNLFKSYEERLSSNEWQAALR
LRKYKTRELDTLIKRFKSSSKGEKTDYSVKIQELQKQLALDKEEAQKIQDDRDRFLSLAL
QGYQRSLVVGGKYDLQVVFRLVSMWFSLFSREQVVKSMIKTTKEVQTYKFIPLVYQIASR
LGSSKDAQGATNFQNALASLLKKMAIDHPYHTIFQLLALANGDRVKDKQRSRSSFVVDMD
KKLAAENLLKELSSFHGALIRQMKQMVEIYIKLAELETKKEDTNKKIPLPRELRNICQLE
LVPVVTATVPVDPDCRYEEGTFPHFSGLLDSVMVMNGINAPKVIECIGSDGNKYRQLAKS
GNDDLRQDAVMEQFFGLVNMFLQNHRDTSERRLRIRTYKVVPFTPSAGVVEWVNGTVPLG
EYLLGSNRNGGAHARYGTGDWTFLQSREYLTCEKDKRKAFLKICDNYRPVMHHFFFERFL
QPADWFQSRLAYTRSVAASSMVGYIVGLGDRHAMNILIDQDTAEVVHIDLGVAFEQGLML
KTPERVPFRLTRDIIDGMGITGIEGVFRRCCEKTLSVMRENKEALLTIIEVFIHDPLYKW
ALSPLKALQRQKETVDTDSCLEDSQEACEGNKDAARAILRVKQKLDGYEDGEMRSVEGQV
RQLIQDAVDVDRLCQMFPGWGPWL
Download sequence
Identical sequences I1HB58
EG:BRADI2G00627.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]