SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G01150.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G01150.1
Domain Number 1 Region: 312-599
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.53e-76
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 43-251
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 7.85e-69
Family Osmotin, thaumatin-like protein 0.000000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G01150.1   Gene: BRADI2G01150   Transcript: BRADI2G01150.1
Sequence length 641
Comment pep:novel chromosome:Brachy1.0:2:726283:728370:1 gene:BRADI2G01150 transcript:BRADI2G01150.1
Sequence
MGVMGIFLTLHNLPPLLLFLLLNFVLPVVTTNSGLTTNSGLTVTLNITNRCSYTVWPAAL
PVGGGMRLDTGKTWTLDVPYDTTRGRVWARTGCSFDSKGHGFCQTGDCSGVLDCRSDGNP
PLTVADFSLNQYTTNSFFDISLYNGFNVPMEFLPIQVKGQGSPGCSKGPHCAANITSQCP
RELKAPGGCNSACTVLNNQYCCSGDDCDSNKYSAFFVRMCPEALSYSRDAPLSTAFTCPF
QTNYQVTFCPPVDLTSSPKSPHGTIAIGASLVLGSVVGFILITAFISYIVYRRRTRRHQK
MEDEEEDFGNLQGTPMRFTFQQLEVATKQFREKLGEGGFGSVFKGQFGEERIAVKRLDRA
GQGKREFSAEVQTIGSIHHINLVRLIGFCAETSHRLLVYEYMPRGSLDRWIYHRQENSVP
PLDWKTRCKIVTHIAKGLSYLHEECTRRIAHLDVKPQNILLDENFNAKLSDFGLCKLIDR
DMSQVVTRMRGTPGYLAPEWLTSQITEKADVYSFGVVVMEIISGRKNLDTSRSEESIHLI
TLLEEKVKSEHLVDLIDKDNDDMQVHKQEVIQMMKLAMWCLQIDCKRRPEMSVVVKVLEG
TMDAETNIDHNFVATSPANLRIAGNVNCSAPLLASEVSGPR
Download sequence
Identical sequences I1HBC4
15368.BRADI2G01150.1 EG:BRADI2G01150.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]