SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G05870.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G05870.1
Domain Number 1 Region: 263-371
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-17
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 52-188
Classification Level Classification E-value
Superfamily POZ domain 0.00000000018
Family BTB/POZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G05870.1   Gene: BRADI2G05870   Transcript: BRADI2G05870.1
Sequence length 583
Comment pep:novel chromosome:Brachy1.0:2:4369017:4373359:-1 gene:BRADI2G05870 transcript:BRADI2G05870.1
Sequence
MEAPLTSHVTTAFSDCDSAPMEMEDDAAAAAADAADVEALRRLSDNLAAAFRSPDRFAFL
TDARLVACPGAPELRVHRCVLSARSPFLRAFFARRAAAEGGVGDRVELRELLGDEVEVGH
EALVLVLEYLYSGRVREPPKSAFFCVDEDGCAHVGCRPAVSFMAQVLFAASVFQVAELAN
LFQRHLLDVLDKVEVDNLPLILSVASLCSKSCMKLLERCLEIVVQSNLDMITLEKTVPQD
VMKQIIDSRLSLGLVSPEDNGFPNKHVRRIHRALDSDDVELVRMLLKEGQTNLDDAFALH
YAVEHCDSKITTELLDIALADVNHRNPRGYTVLHIAARRRDPKIVVSLLTKGARPSDVTS
DGRKAVQISKRLTKHGDYFGVTEEGKPSPKDRLCIEILEQAERRDPQLGEASVSLAMAGD
CLRGKLLYLENRVALARILFPIEARVAMDIAQVDGTLEFTLGSSANQLPEIPRATVDLNE
TPFKMKDEHLARMTALSKTVELGKRFFPRCSKVLDTIMDDETEATELASLGRDNTSTERK
RRFHDLQDVLQKAFSEDKEEFARSALSSSSSSATSIGGVRPRR
Download sequence
Identical sequences I1HCY0
EG:BRADI2G05870.1 XP_003564857.1.954 15368.BRADI2G05870.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]