SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G10160.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI2G10160.1
Domain Number - Region: 124-180
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0388
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G10160.1   Gene: BRADI2G10160   Transcript: BRADI2G10160.1
Sequence length 310
Comment pep:novel chromosome:Brachy1.0:2:8359697:8360629:1 gene:BRADI2G10160 transcript:BRADI2G10160.1
Sequence
MASGTRLVPAQGGLGGALLLNDGRSGEHVAVIKPLEDDASNGDGGGYESEAVLREVAAFL
LDHGGFASVSPTALIRISRPDMDTTTMASIQRFVAHSHDAGELGPSRFSATSVHRVGILD
VRLLNIDRHAGNILVKNDTTGTDWAAPLELVPIDHGLCLPERLEDPYFEWLHWPQASMPF
SAEELRYIASLDAPRDAELLREELPAITEPAIRILTLCTVFLQRAAAAGLCLADIGDMMT
REFSSAEEGVSVSELEALCNKAVDDGDRRTEESSPRHVSFGELSAEEWAAFLEKFERLLP
PAFEAKMKKL
Download sequence
Identical sequences I1HED0
EG:BRADI2G10160.1 15368.BRADI2G10160.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]