SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G10870.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G10870.1
Domain Number 1 Region: 85-143
Classification Level Classification E-value
Superfamily F-box domain 0.000000000196
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G10870.1   Gene: BRADI2G10870   Transcript: BRADI2G10870.1
Sequence length 411
Comment pep:novel chromosome:Brachy1.0:2:9093654:9097167:1 gene:BRADI2G10870 transcript:BRADI2G10870.1
Sequence
MLALVATFVFSCLLFLSKPCARDMRFFLASLCQELALSLLGFLAGYRLLGGVASTPAPTR
APADAMPLMPSFKRKRPVAKVESAEATGDPSLLDLPELTIDCILARLPPAELRNMAAVCR
SMRDRCRADHLWESHMSDKWGPVMGAAAREEWRSYLSSSSAADGGGGAAGCGSGGGVKRR
RWLAALSCVCPVVSWIRPRADGGAGKSAGPVLDDSVMSWYLHMESGKFWFPAQVYNREHG
HVGFMMSCYDAELSYDFHTDTFRARYPPHGRRTVVLEDGVQWDRVRAPPVDTLAHDLHVS
DCLHELRPGDSIEIQWRRNKEFPYGWWYGVVGHLESCDGNEHFCRCHLSDTIVLEFNQYT
PGSRWRQSLVNRKDHREEGNEGDGFYGGIRKLHSKDEISKWKQLWPIDILE
Download sequence
Identical sequences I1HEL3
15368.BRADI2G10870.1 EG:BRADI2G10870.1 XP_003567352.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]