SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G19240.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G19240.2
Domain Number 1 Region: 125-159
Classification Level Classification E-value
Superfamily F-box domain 0.0000000602
Family F-box domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G19240.2   Gene: BRADI2G19240   Transcript: BRADI2G19240.2
Sequence length 271
Comment pep:novel chromosome:Brachy1.0:2:16954837:16958771:-1 gene:BRADI2G19240 transcript:BRADI2G19240.2
Sequence
MPVRRRMPHQRLVERRQENGIVKRYKEMGIAAALSRPWDYPTACRELAELLRHGYAGLPK
AAKALVASDVLTAFRLLPDVHTGYALPAANGLLQAVEVSLPKQKKSQAISEFKCSVVAHK
RRARVQQEPGPPHIPHDVLVHIFSFLDMRSLVAAGLVCCTDPVSGDSSLNWKEVFHNKRA
EYILWSSASNKAVCRQCQAIIWLSNLTCAAPHQCPNKNEKDGVKLTPLLPSTVTGYILNS
HGRLSSSSDSDDTDSDSEDNTSRRFWSCHLD
Download sequence
Identical sequences I1HHD9
EG:BRADI2G19240.2 XP_010231136.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]