SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G20517.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI2G20517.1
Domain Number - Region: 462-499
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00214
Family SPT5 KOW domain-like 0.071
Further Details:      
 
Domain Number - Region: 564-606
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0346
Family N-utilization substance G protein NusG, C-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G20517.1   Gene: BRADI2G20517   Transcript: BRADI2G20517.1
Sequence length 1539
Comment pep:novel chromosome:Brachy1.0:2:18008901:18020531:-1 gene:BRADI2G20517 transcript:BRADI2G20517.1
Sequence
MAVKGKGKQVASDTPGSSGAKRRSGTGGAGPSSSSAAAAKRRRRPGVLQFFDDQAGVDDD
CEDEEEEEEEEFDSEPEDGPDHGFFREKKTASANMMRTERSHPLPFLAQVKEEELSGDEL
EQFVKDRYSNRVKHSGYGGSTQEYDDDCTMDDALKEPTIWRVKCMVGRERQMAFCFMQKF
IDLKKFGTKVPIISAFSLDHMRGYVFVEAEKACDVTEACKGFCNVYVSRTSPVPAAEVPS
LLSTRAKPFEVSPGTWVRMKSGNYKGDLAQGGAVSLKDAAVPAPRLISSQELEFFGPHIE
RRADRQTGDVFEVLDGLMFKDGFLYKRVALSSLIYWGIQPTDTELLKFSSSPSIKSSADD
MDWLSSMYGQKKRNVPREHDMNASSSKDKCSKASNLKGSTSTESYDDDVNDAFNLHDLVL
FGRKDFGVIIAVEKDGFKILKGGPEGSAVTVRKQDIKKGCVDKMFTAVDHQKKIISINDT
VKVLEGPAQGKQGVVKHLYMGILFIHNDSESENNGFFCAQCGSCENIKKRRELASSEDNP
ISMFSDSPFMPSEQTEQRNNDRPYRAREQLFSIGEMLRIRKGPMKGYLCRVVRIFRNDVT
VKLDSLLKIVTVQAEFLSVPTKRGDNSSSAAAGPFGTQDTSFFGSEAEKTSWNNGLTSLG
SDSWQPPSSSAFPFQNADGGAEADPWCKKTSSSADGDCDPWCKKTTSADVGIWNNSTTQK
DSSSDNSWDKQAGGGGLDVGGSSWAGAAVNKQSEKSDNWGEACKAVDMATGGNTDPWGSK
VKVVTEEADGWGKSSLPPEKKLEDDGQGWGRSFGTSNKEQEKEAVSKVADNSRSWDTAIA
ICDGSGDDAWGKSKENNGDGAVGWNKAITSNQNSGSGGWDTAAANWSKPSPVGQGHEEAW
GKEKDSAAKSEEINDGGGSWKKAGSSDQVGAGDWDKPKFSGNAGPSSWNKGEAVGGDNQN
SNWSKPGGNFEGGRGFGRGRGRGWGQESGDLGGRNDQGNLNSSWGNDSSARPSWRSDTQV
SNEGGDSGGGGYRGRGRGRGQYGGRGRGRDNVWGNGDRGSSEFGREGSSGDTLNWENSQP
CRGSEGTKPCDENQTSTWNSSDDKKASGGEPNDPWASKMTTKGQEQQCDAWSSKMTSTAG
AENNNDSWNTKAKEPSCSDGTNWENAVSGEERQGDPWASKTDCSTKGGNGNGGGWNNTGS
SAAWSKPSSTSGDQEPAWSKPTYGDDDTGYGRGGFGRGNRGRGRGRFGDGGSSWNGGSNL
NDESGGERSEDRWNRRDSDGGRGRGRGRFGRGDRHQDNFGSGDGDGGSWSSGRGNRGRGG
GYRNWNDNNEGRSFSQGRGGGWSQSSDWNAGKKESTEGDQDFSKGKSSWGGDKNDSWGGP
KQSGGDDQAGKSDGSNAWNQNKPSLGDGSSVLGQWGGPSGDTTTSRGGSVGGGGSCGNSE
NQAFSKGKSNWGSDKNDCWGAPKPHGGDDQAGKNDGNNSWNQTKPSLGDGPSILGSWGKP
GGSGSGCGSQGGGGSSWDKGNAGGWNSNKGGDTSKGGGW
Download sequence
Identical sequences I1HHV8
EG:BRADI2G20517.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]