SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G22330.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G22330.1
Domain Number 1 Region: 344-624
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-67
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 32-265
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.63e-48
Family Legume lectins 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G22330.1   Gene: BRADI2G22330   Transcript: BRADI2G22330.1
Sequence length 666
Comment pep:novel chromosome:Brachy1.0:2:19862702:19864730:1 gene:BRADI2G22330 transcript:BRADI2G22330.1
Sequence
MRSSALPLLVLLFPLFAVNLPSAASSPAASHRRISWASNLTLLGSASILPGAAAVALTTN
SSDGIGAGRALFSEPVRLLLPPPDPRAAPAQASFSTRFTFHITPSPSFGDGLAFVLTSSC
TFLGASNGFLGLFPSSSASDDGDLADVSTVAVEIDTHRDAALRDPDGNHVALDAGSIFSV
ASASPGVDLKAGVPITAWVEYRAPRRRLRVWLSYSSSRRPEKAALSVDVDLSGLLRTFMY
AGFSASNGEGSALHIVETWTFRTFGFPNSSHASPPPNQEPHKNPLPLSTNHHRHRGLLYK
VLGGVLGGAVLLVLVVIGSILWLGHTKRRTSEEPTVLIEDKNFRGMLSMEVIRAATKDFS
SENVIGIGGSGAIVFEGVLPSGSRVAVKRFQAIWPCSKAFDSEHHAMLDCPHHPNLVPLF
GWSSSEHDLVLVYEFMPNGNLDNALHSLGGAILPWEARFGAVIGVASALTFLHDECEHRI
LHRDVKSSNVLLDADFKARLGDFGLARVVSHGGVPLATQPAGTLGYLAPEYVYSGVATER
SDVYSFGVLALEVATGRRPTEKGTAVVDWVWALWGRRRLVDAADQRLQGRFVAEEMRRVL
LVGLCCVHPDCRKRPGMRRVVRMLDGTAPMTLVPDKKPPVVLKSTLNQTSSINTADTMNT
AFYSCR
Download sequence
Identical sequences I1HIF7
XP_003566141.1.954 15368.BRADI2G22330.1 EG:BRADI2G22330.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]