SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G31610.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G31610.1
Domain Number 1 Region: 581-754
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.4e-43
Family Retroviral integrase, catalytic domain 0.0068
Further Details:      
 
Domain Number 2 Region: 1001-1220,1248-1433
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.34e-25
Family Reverse transcriptase 0.067
Further Details:      
 
Domain Number 3 Region: 276-316
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000541
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G31610.1   Gene: BRADI2G31610   Transcript: BRADI2G31610.1
Sequence length 1488
Comment pep:novel chromosome:Brachy1.0:2:31479730:31484196:-1 gene:BRADI2G31610 transcript:BRADI2G31610.1
Sequence
MSTTPGKGGDLTTAGKYTTPARRAGDDGGSGSGGRRGPKVPIQYPMLTESNYQLWAGKMK
ILLRHLGVWTAIEDDGVDEETDQGAMTAISQSVPDNVMMSIMEHETAKAAWEAIRVSRIG
EERAVEARVQSLMRRFDRLVMQDGENVAAFSRRLNALVGEIRGLGEKLPEKAVVRRLFAA
MPRRFSSIIGTIQQWGDMKTMSVAEAIGRLRAFEENEEDSQDMRGTGDEQLMLVSKALES
LLKGKKIVNDASSSSTGGKKANTGRDRAPAQHGKGNDRGKPQKKHRKFDKSKIKCFNCDE
MGHFASECKEPKRERAHYAEQDDGDHGVLMMIEKIEDPVSPVAEKPVVKPCQIATAAEYP
AARQPTSCTTEIVLLNEEKVRPRLVGMRERDAWYLDSGASNHMSGCKELFHDLDESVGGK
VRFGDGSVVEIRGRGKVLFECMNGEHLILTGVYYIPRLKSNIVSLGQLDENGLKTVIVHG
YLWLYDHGRLLAKVKRNWSRLYVLNTTRAEPVCLLVKGSEKEWLWHARFGHVNFRALRDM
SRLEMVEGLPHIDHVEQVCEACLAGKQHRMPFPKVASYRATAPLELVHADLCGPITPATP
GNKKYFLLMVDDFSRYMWIVLINSKDQALEALKKVQIRAEKECGSKLMSLRTDRGGEFVS
GDFGRHCDGLGIKHFLTSPYSPQQNGVAERRNRTIVEMARSLLKNRNVPGRFWGEAVVTA
VYLLNRAITKSVKDKTPYEAWHARKPKVQHLRTFGCIVHVKVVKPHQKKLEDRSRPMVFI
GYDPTAKAYRAVEPASNRVTVTRDVVFEEEKGWNWEQGKESNTDGGDATFTVVWPTMPAA
AASRQNPAEAVQETAAAETPAAAGSAAGPSTTTSTLGAPCKHAGVSTWQEAGSPSSASKD
VGCATPTFNTYAAAIDAAAAGVSSGAAPSTGAPPSYSSVGLQGMRPLDEIYDETNEVHAE
YSGFCMLAAEEPSGVEEAMKIPAWREAMETEMQSIMENRTWEEDVLPRGHKAIGLKWVYK
VKKNSEGDIVKYKARLVAKGYAQRHGVDFDEVFAPVARMETVRVLLSLAAHEGWEVHHMD
VKSAFLNGDLAEEVYVQQPPGFPSACREGKVLRLSKALYGLRQAPRAWNAKLDNTLLSLG
FEKCPMEHAVYRRREGQKNLLVGVYVDDLIITGSEVEVINGFKDQMKALFSMSDLGKLSY
YLGVEVKQSKNGISVCQAGYAQKILEHFGMGECNACATPMENRLKLSKKSSDPPVDPTEY
HSVVGSLRYLVNTRPDIAYSVGIVSRFMESPTTQHMAAVKHILRYVKGTVGYGCVYAKNG
DSEAKLEGFSDSDLAGDIDDRRSTSGMVYFLGSNLVTWASQKQKIVALSSCEAEYIAAST
AACQGIWLSRLLGELKKQATQKVTLNVDNKSAIALCHNPVLHDRSKHIDTRYHYIRECVE
ENKIEVKHVSTEEQLADILTKPLGRLKFLEMREKIGVQEVKEGIKVRG
Download sequence
Identical sequences I1HKQ7
EG:BRADI2G31610.1 15368.BRADI2G31610.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]