SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G41690.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G41690.1
Domain Number 1 Region: 846-1102
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.47e-58
Family WD40-repeat 0.0000916
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G41690.1
Domain Number - Region: 1162-1203
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0311
Family WD40-repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G41690.1   Gene: BRADI2G41690   Transcript: BRADI2G41690.1
Sequence length 1205
Comment pep:novel chromosome:Brachy1.0:2:42055068:42073046:-1 gene:BRADI2G41690 transcript:BRADI2G41690.1
Sequence
MASTSRIFEYFVVCGLGPEIRALDGVKGFHGADEMYMPAFIDQFPHSGHALYPPPPPQLP
TCVLPAGVRVYSSGLDANDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAYQI
PVNSFADKCICFVSHSPSFQVLRDALEEIFVLCFSPAGCSKPLWDIISHVVSNVPLPTPG
KDRVLFAIDNCLLSVETPPKEWLPHADISFQPLVQCLDVDKLIQLFTAVLLERRILLRSN
KYTLLTLVSEAICHLIYPIRWQHVYIPIIFSSGVDYIDAPTPYMMGLHSGVDTSTVTMDG
VVVVDLEYNRITTTEEIPPIPETELSFLRGEILKLLQPNVVSIDYMKINLGSMGDHSIRA
GTKSWGQEHDFQLRMIFLRFFAQIMSGYRNFIDNALQTGFNSQAFLKKRSRATNQPVESM
SMIMQFIETQGFLDYLERCNNSEEYTNNLLDKLQDATGRGQSPLAIFPSHVADPEIITIA
DSETVGSEPGNRHCYKSFPANARTEDQEEKRKSILALASGASKQVPSSPAVRINGGPKAE
SLSPRERAAERERMVLDIKVKLQGLWLRLLRLGATEDPLSSFEYGTILALIESDAEGIGG
SGFVECIREHIHSGWQCRLTDEQFIAVKELLKTAITLANSRDDVSTIRDALEVSAEMYRK
DPNNVQDYVQRHLLSLSVWEELRFWDGYFEYLMENCSNKSTNYVTLVTAQLIVMATHMAG
LGLPDIDSWNMIEKIAERNNLGYKQLIKLRALLTHLQQLRVGYWGAPVGKNQPLPSYSMA
SPRALDISDESEQPAEASVLGRSWVHSMFSRDRSLRASSFNRASDPKAGATAGKTDLAAA
QKKTQTNMRILRGHTAAITALHCVTRKEVWDLVGDREDAGFFISGSTDCTVKVWDPSLRG
SELRATLKGHTRTVRAISSDRGKIVSGADDQSVIVWDKQAFMLLEDLKGHDAPVTSVRML
SGERVLTASHDGTVKMWDVRTDACVATVGRCQSAVLCMEYDDSTGILAAAGRDVVAHVWD
IRSSKQMFKLQGHTKWIRSMRMTRETIITGSDDWTARVWSLTRGTCDAVLACHAGPILCV
EYSPSDKGIITGSSDGLIRFWENEGGIRCVKNLTLHSASVLSISAGDHWLGIGAADNSMS
LFHRPQERFGNFSNTGSKVAGWQLYRTPQKTAAVVRCIASDLDRKRICSGGRNGLLRLWD
ATTSI
Download sequence
Identical sequences I1HNT3
15368.BRADI2G41690.1 XP_010231941.1.954 EG:BRADI2G41690.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]