SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G45870.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G45870.2
Domain Number 1 Region: 9-307
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-94
Family Protein kinases, catalytic subunit 0.000000204
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G45870.2
Domain Number - Region: 406-456
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 0.0565
Family HTLV-II matrix protein 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G45870.2   Gene: BRADI2G45870   Transcript: BRADI2G45870.2
Sequence length 566
Comment pep:novel chromosome:Brachy1.0:2:46303932:46308387:1 gene:BRADI2G45870 transcript:BRADI2G45870.2
Sequence
MDFFSEYGDANRYKIQEVIGKGSYGVVCSAIDQHTGDKVAIKKIHNIFEHLSDAARILRE
IKLLRLLRHPDIVEIRHIMLPPSRRDFKDIYVVFELMDTDLHQVIKANDDLTKEHHQFFL
YQMLRALKYIHTANVYHRDLKPKNILANANCKLKICDFGLARVAFNDTPTTVFWTDYVAT
RWYRAPELCGSFFTKYSRAIDIWSIGCIFAEILTGKPLFPGKNVVHQLDLMTDLLGTPSL
DTVSRIRNEKARRYLSSMRKKQSVSFSERFPKADPAALKLLQRLLAFDPKDRPTAEEALA
DPYFKGLGKVEREPSCQPITKMEFEFERKNVTKADVKELIFREILEYHPQLLKDYMNGTE
KTNFLYPSAVDNFRRQFANLEENGGKGGAVVPPDRKHVSLPRNTTVHSTPIPPKDQKYSQ
VPQRIPTGRPGRVVGPVIPFENSSTMDPYSQRRVARNPVLPAAATNLSAYAYRNSDNSER
ELQQELEKDRMQYHPMQRFMDAKMVSPDLRSTSYYMPKGVPKADVAERSALQSNMMQGIA
PFNGIATVGGAFNKVSAVQYGVSRMY
Download sequence
Identical sequences I1HQ56
XP_010232110.1.954 XP_010232111.1.954 EG:BRADI2G45870.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]