SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G51017.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G51017.1
Domain Number 1 Region: 530-803
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.87e-48
Family Tandem AAA-ATPase domain 0.051
Further Details:      
 
Domain Number 2 Region: 182-381
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.57e-31
Family Tandem AAA-ATPase domain 0.059
Further Details:      
 
Domain Number 3 Region: 21-80
Classification Level Classification E-value
Superfamily R3H domain 0.00000000235
Family R3H domain 0.0069
Further Details:      
 
Domain Number 4 Region: 435-509
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000575
Family Ankyrin repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G51017.1   Gene: BRADI2G51017   Transcript: BRADI2G51017.1
Sequence length 1195
Comment pep:novel chromosome:Brachy1.0:2:50685769:50695622:1 gene:BRADI2G51017 transcript:BRADI2G51017.1
Sequence
MGRKGRKGNDGGLGGLSEETLVRVTTVLEEFRASDAQVHTFEANISKQERAAIHEICRKM
GMISKSKGYAERRCLSVYKRKQTQGPDKEEGPSKLGFSEEARNVLQDLFTHYPPTDAELN
GEAVKNSSDKAAKIQWKTDSAFCRPVMHKHDIAKKVEILASKINESRQLRKIVEDRSKLP
ISSFKDHISSTLENNQVVLISGETGCGKTTQVPQYILDHVWGKGESCKIICTQPRRISAI
SVAERISAERGEVVGDTVGYKIRLESKGGKNSSIMFCTNGVLLRLLIGRVTNMPKAKNPK
RSFDDAVMGITHIIVDEIHERDRFSDFMLAILRDLLPVYPHLHLVLMSATIDAERFSQYF
NGCPIIQVPGHTYPVKIFYLEDVLSILQSVGDNHLNPATDDLEQDSILTDDYRSSMDESI
SMALANDEFDPLIELISVEQSPEIFNYRHSESGVTPLMVFAGKGQIGDVCMLLSFGVDCS
ARDHDGKSALDWAQQENQQQVYEVIKKHMDCGSVKSPQENELLNRYLTTINPEHIDTVLI
ERLLRKICIDSNEGAVLVFLPGWEDINQTRERLFASPLFQDSSKFLILSLHSMIPSVEQK
KVFKSPPVGVRKIILSTNIAETAVTIDDVVFVIDSGKMKEKSYDPYNNVSTLHTSWVSRA
SARQREGRAGRCQPGTCYHLYSGFRAASLPEYQIPEIKRMPIEELCLQVKLLDPNCRIAD
FLKKTLDPPIPETVKNAITVLQDLGALTQDEQLTDLGEKLGSLPVHPSTSKMLLFGILMN
CLDPALTLACAADYRDPFVLPMAPDERKKAAAAKVELASLYGGFSDQLAVVAAFDCWICA
KDRGQEALFCSKYFVAANTMNMLSNMRKQLHSELSQRGFLPADASACSLNAKVPGIISAV
LVAGAYPMVGRLLPPRRNCKRAVVETASGAKVRLHPHSCNFNLSFNKSYGNPLMIYDEIT
RGDGGMYIKNCSVVGSYPLVLLATEMAVAPPDDSDEEEGSSEDEAEKNTSGQQNEEIMSL
PDNTVSVIIDRWLRFDATALDIAQIYCLRERLASAILFKVKHPQDVLPPALGATMYAVAC
ILSYDGLPGMVESADLSTNRGSNQSSTEASRFTQGRRASYIPPGGFLMSLLSDIPPNAPQ
FRKSSHHPGGASGHIRPSRPSAGRFNQSKQHPRRSSSGQGSSAPESFKRQRDGAR
Download sequence
Identical sequences I1HS06
XP_003567152.2.954 EG:BRADI2G51017.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]