SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G51170.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G51170.1
Domain Number 1 Region: 29-505
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.57e-121
Family Pyridoxal-dependent decarboxylase 0.00000000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G51170.1   Gene: BRADI2G51170   Transcript: BRADI2G51170.1
Sequence length 521
Comment pep:novel chromosome:Brachy1.0:2:50807524:50809642:-1 gene:BRADI2G51170 transcript:BRADI2G51170.1
Sequence
MAPPSHFSNVAATVPVVVDKPQQCSNALDADDFRRQGHQVIDFIAEYYGGMADYPVHPSV
TPGFLRNLLPASAPSRAEPDAFSSALKDIRDHILPGMTHWQSPRHFAHFPASSSTVGALG
EALTAGINVVPFTWAASPAATELEMVVVDWLGKALHLPETLLFAGGGGGTLLGTSCEAIL
CALVAARDRKLAEIGGRRIGDLVVYCSDQTHFAFRKAARIAGILREHIREIQTCHANMFA
LSATALEAAMQADVEAGLVPLFVCATVGTTQTTAVDPIGELCTVTAPHGVWVHVDAAYAG
SALVCPEFRHVINGVESVDSFSMNAHKWLLTNNDCCAMWVKKPSELIAALGTEQEYILKD
SASEGHDIVDYKDWTMTLTRRFRALKMWLVLRCYGIDGLREHIRSHVRMAEAFENLVRAD
ERFEVVTDRQFALVCFRLRSPEKYGGEKTANELNRSLLEEVNAVTLGPYMSSANVGGMYM
LRCAVGSTLTEDCHVTDGWKVVQDRATSILRKMEIIYSVLG
Download sequence
Identical sequences I1HS24
XP_003569911.1.954 EG:BRADI2G51170.1 15368.BRADI2G51170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]