SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G60830.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G60830.1
Domain Number 1 Region: 270-660
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.58e-96
Family Regulator of chromosome condensation RCC1 0.00051
Further Details:      
 
Domain Number 2 Region: 23-130
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-26
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 3 Region: 659-729
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.11e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0028
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G60830.1
Domain Number - Region: 873-930
Classification Level Classification E-value
Superfamily Tropomyosin 0.0177
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G60830.1   Gene: BRADI2G60830   Transcript: BRADI2G60830.1
Sequence length 1092
Comment pep:novel chromosome:Brachy1.0:2:58086819:58093286:1 gene:BRADI2G60830 transcript:BRADI2G60830.1
Sequence
MSDASSDLGGVGLRAGPPVERDLEQAITALKKGAYLLKYGRRGKPKFCPFRLSNDESVLI
WFSGKEEKHLRLSHVSRIMPGQRTAIFQRYPRPEKECQSFSLISQDRSLDIICKDKDEAE
VWFAGLKTLISRSHQRKWRTESRSDTISSAATSPRIYTRRSSPLSSPFSSNDSLHKDGNE
NYRFRSPYGSPQKNGLDKAFSDVVLYAVPPKSFFPSDSNARSVHSMSSGHSDNTNGHPRG
IQMDPFRASYSSAVSSSSYGSGYDDGDALGDVLIWGEGTGEGILGGGSSRIGSSSGAKMD
CLVPKPLEFAVRLDVQNISCGGKHAALVSKQGEIYSWGEESGGRLGHGVDCDVAHPKLID
ALTHMNIELVACGEYHTCAVTLSGDLYTWGDGTFKFGLLGHGNDISHWVPKKLHGPLEGI
HVSSISCGPFHTVIVTSAGQLFTFGDGSFGVLGHGDRESLSVPKEVESLKGLRTVRAACG
VWHTAAVVEVMAGNSSSSNCSSGKIFTWGDGDKGRLGHGDKESRLVPTCVAALVEPNFCQ
VACGHCLTVALTTSGHVYTMGSAVYGQLGNPQADGMLPARVEGKLHKNFVEEISCGAYHV
AVLTSRTEVYTWGKGANGRLGHGNTDDKNTPTLVEALKDKQVRNVVCGTNFTAAICIHKW
ISGVDQSMCSGCRQPFNLRRKRHNCYNCALIFCHSCSSKKSLKASLAPNPSKPYRVCDSC
YSKLTKGLETDMYSSAKRGAVVQGFSDTVDEDTETRSNAQLSRMSSIDSFKHMDSRYSKK
NKKFEFNSTRVSPVPNGGSHWSGLNISRSFNPVFGSSKKFFSASVPGSRIISRATSPVSR
RPSPTRSTTPTPTFGGLTSPRVVVNGAKPTNDSQTQEILNLRSQVDNLTRKYQLLEAELE
RTTKQLKEAIAIAGEETAKCKAAKEVIKTLTAQLKGMAEGLPGGAAKSSKLPPLPAIPIP
SDISAMVTECLGSPDSSEEQVHISNGPNGLLVSNGPSSTRNKASHSEMASNGSRTPDPES
YHEAEWVEQDEPGVYITLTALHGGARDLKRVRFSRKRFSEKQAEQWWQGNRARVYQKYNV
RMVDKSVAGMDS
Download sequence
Identical sequences I1HV82
EG:BRADI2G60830.1 XP_003565075.1.954 15368.BRADI2G60830.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]