SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G62400.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G62400.1
Domain Number 1 Region: 17-249
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.44e-45
Family Ankyrin repeat 0.0004
Further Details:      
 
Domain Number 2 Region: 306-370
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000897
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G62400.1   Gene: BRADI2G62400   Transcript: BRADI2G62400.1
Sequence length 452
Comment pep:novel chromosome:Brachy1.0:2:59060728:59062667:1 gene:BRADI2G62400 transcript:BRADI2G62400.1
Sequence
MGHGLSCGRDGEEHEFFRAAQSGDADAMDGLLAGDPSLARRATIYDRLTPLHVAAANGHL
EAVSLLLDRGRAAPDALSRTKQTPLMLAAMHGKLDCVLRLLHAGANILMFDSVHARSCLH
HAAYYGHGDCLAAILAAARTAPVAASWGFARFVNVRDEHGATPLHLAARHGRAGCVHALL
DAGAIVSAPTGSYGFPGSTALHLAARGGSLECVRELLAWGADRVQRDSAGRIAYAVAVKR
RHGGCAAALDPGAAEPMVWPSPLKLVAELDAGARALLQAALADANKKILTRLKASGNTSA
GREEEEEEEEEDEELCSICFEQACSMEVEDCGHRMCAACTLALCCHSKPNPATFTANPPA
CPFCRTSISRLVVAESKAKAKAVAITGDELEEKAAAMVGSPRLSRRRSSSFKGLSSAVVG
SLSCKIGRGSGRLAGDSNGGGGGFLDKPEHDP
Download sequence
Identical sequences I1HVR7
EG:BRADI2G62400.1 15368.BRADI2G62400.1 XP_003565178.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]