SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G02497.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G02497.1
Domain Number 1 Region: 430-554,716-770
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000000229
Family WD40-repeat 0.0075
Further Details:      
 
Domain Number 2 Region: 1775-1830
Classification Level Classification E-value
Superfamily RING/U-box 0.00000656
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G02497.1   Gene: BRADI3G02497   Transcript: BRADI3G02497.1
Sequence length 1965
Comment pep:novel chromosome:Brachy1.0:3:1498413:1511834:-1 gene:BRADI3G02497 transcript:BRADI3G02497.1
Sequence
MASQPPTQLQQQEIDVDNLLPSSPASSAASDADADHRRAVDDLLLLLSSSDSDSDEPSRS
SSSPSTSLKPLPRIQAPPPRQLPKPSPPPSPSPSASDSPRRSTSASPPSATLSSLVTRTF
SNSAASSSRPLPSLFRGVRPSPKPGAALAAAAAASRAVLTPHAAAIKSRRTASAPVDKSL
DEGTGSEASEGLPSTGNLEAEVAAEKVSAEVVAGVTEETVGGSKVEELEDGKHGDVGIEV
NSEPAESVRAGDVDSVAAGIVDEHEQIGGENLAETVQVGSQVGFVDEGSGDEQIRDENSM
ESDEIVDEVGSVSEENSDDEQEVQVSDNAVEEEVESVDIIDKVIEERLEISRKAEKITEK
KLKVSMKPLEWAEELEKRQASFGQHWEEGAAAQPMRLEGIGKGQPAIGYMQIEVDNPITR
AMASPSFRQDHGSPQVLAVHRSYIAMGMSSGAVIIVPSKYSSHQADDTDAKMLFFWNQGE
KTQSPVTAMCFNPQGDLLLVGYGDGHMTIWDVQKATAAKVIHGEHTGAVVHVCFIRQSKA
ITGDSKGLVLLHTFSIIPVINRLTVKGTQLSACLVSQNKATFSQRLFDGNTGIVLSACPL
LVDESLYSSNSSTQGNITSSSSGGLGSMMGGVVGVDSGWKFFNEGSSPVEDGVTVMFIMH
QHALVVRLRTNIDHVDHIETFSRPEGAREGSIAYAAWKYTASSSDSPSVDEDRVSWLALA
WDRQVQVAKFVKSKMIRHKEWKLDSSAVGVAWLNDQMLAVLNLRGQLCLFSKDGSELRRT
IFILDGFVFDDSILYHTHFLNRFGNPERHFKNSVAVRGATVYILGPNFLTVSRLLPWKER
IEALKRAGDWMGALDMAMKLYDGHTQGVVDLPRTVDSIREAIMPYLVELLLSYIGYVFEY
ISIALSNHTGKGGGADDLVDTDRSLLTQREEQYARVGGVAVEYCVHIGRNDILFDTVFSK
FAAAQSGGMFLEVLEPYILKDMLGSLPPEIMQALVEHYSGKGWLQRVEQCILHMDISSLD
FNQVVRLCREHGLYGALIYLFNQGLNDFRTPLEELLSVIQSATRKDATSTCYRMLVYLKY
CFQGLAFPPGHGIIPRAHLHSVRKELLQFMLEESKMLTSEVFKGFNSSCGKCPNICYLLW
MDTEATLEVVKCAFAQESFEPTSGILDASVPTDEGDTNTGSPESQNILLQSVVDTIIDIV
GLENEATHSIFAGTAESENSEFWPSVNDLGYIIEFVSFFVCHKRANTSQRVLRHIVKYLT
LSNTQSYDDKKLPTQKEEEVLQLFNVVPQTDWNSDYVLHLCLDAHFHQVCYYYLESKPLW
YSTVAQSPFSPRTENIPVTMQACGLIYAARDQNLAALDSYMKDIVEPFHAFIFINKKLLQ
LAGDEVLSFRSTVISRFPELVNLSRECAFVLVIDHFHNEIQQMLAELHSDHCSLFLFLKT
AIEVHLSGKLDFSKLTARNDKIVERQYFSGELEDYLQRLSNLPKLFDRNPVSLTDELVEL
YLELLCQYEPRSALRFLETYDSYRLERCLHLCLDYGVTDAAAFLQERVGDVGSALALVLA
GLDEKISQFISSVENTFSRISPKSISEIEQPDVVLKMSEAHPVLDTLRASIGLCQRNSQR
LDPEESQLLWFQLLDSFSEPLKKLYGGKVVNGKGGRSEGGETTNGYPKGNGQMRISTYEK
CLNALRRVFSQFVGEIIEAMAGYIPLPAIMAKLLSDNGSQEFGDFKLVIHRMLSMYLYEK
RILETAKSVIEDDSFYTLSLLKRGVCHGFAPQTFVCCVCNCSLSKEGAISAVRVFSCGHA
THLHCESEQSKSSNRDSKDGCPVCLSTSNTQARNKSSIISENGLTRYSVVENEVSHGIHH
VHETDHAERSRGLQHMSRFEILNNLQKAHKTFHIETVPPLRLSPPAIYHEKIQKRVTFVG
ESSRHSVRTEKPQKIWQMKEPKLKKSGNWLPAKTSIFSSDKNQVR
Download sequence
Identical sequences I1HWQ2
EG:BRADI3G02497.1 EG:BRADI3G02497.2 EG:BRADI3G02497.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]