SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G03637.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G03637.1
Domain Number 1 Region: 161-285
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000366
Family WD40-repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G03637.1   Gene: BRADI3G03637   Transcript: BRADI3G03637.1
Sequence length 1522
Comment pep:novel chromosome:Brachy1.0:3:2414390:2428295:1 gene:BRADI3G03637 transcript:BRADI3G03637.1
Sequence
MATPAPAPASRRIAGTEVPITGSDKIRWIDLTVPSSSSAPESATDPFVSVPPRAASGCHI
VYPGSDSQRYLAWRIHEEHQNVLEVIELCASKEFPSSGLRLIFEEELCPFAFICESEGAR
RDKSVYLLYVVTVSGVAFLCNLHSPFSYVSGSILAQNDIVEFSLQTLTQSAKVTAVKAKP
GCLVIGRQDGSICCYSLGKVAPCSPGFSNELRDDAGIGRLWTLMSRTKAVGPVQDIETAI
VNERELLFVLHLDGSLRVWDIFSHTKVLNYNVQSNGFEGQPSRLWVGEADDDQELITLAV
LHQGTVVPACDRVAVYGFSFGAGEKFLLSPEPSVFDVPLLEGKLVDLKISTEKLWILKEV
GPMLYEIVQYDTDTGEMCSYVLQEDAISEQMFQSSESALDDLVWTADSIFSSTKEHSFSF
ISSMFLRRLLQPGVNHWCALRETLLEYKRFLSDSEFQSLTTSGLGKEILSIIEQEESSQT
ASSTAYHWKKFSARYLHNWCRNNRPYGLLLDTNGEVFGLIRKGSFSLFRCLERVEQLIYG
FSDELGNLNGLELTILSEKSETEILIEVLTCMGHIHHLLGRSSAAIYHESLISSVISLDE
IASQILKILETGFSPQSSSALIALLGTDAYVERRQIAHKSQRKFSVEMLLSFQKLQSRSI
SWPAVFDVIERFMKYLNTELTRQECESKRVCNINSMLLVQATSQVARTMFESAFDLFLFL
RYLVGVGGQVSLLQSDAARIKLKLLPMIQDILGQWIVLHFIGISPTMPPTIEDFSYQLSS
LQLGIADELSLHRKLGSSDFTLACLLDFPKSAEGDALSPCFPTPAEVINLVRRFSSSIMC
RSNVEHVDGFLDTSWVHSFLGSTINLAALFVRHGQYGAAENLLGILETYWNNGRASQTDK
DTDIASLARLHLNGFCLLMLAHDEANIVLKESKVHEAIRCFFRAASGQEAPKALKKFSSE
TGFQFSGECRSISLWRLHYYEWAMQIFEQHSMSEGACQFALAALEQVDSIFYLNNGSDAE
DLPETAAMIKGRLWANVFKYSLDLKKFHDAYCAIISNTDEDSKYVCLRRFIIVLCELGET
KVICSGEIPFTGLVEKVEQELFWKAERSDLSSKPNLYKVLYSFEAYRNNWRKAAAYMYRY
FVRLSREGNAGGTLQLSHVLQERLHALAAAINSLQLVDPSSAWLDSVCEADDQISPSKKP
RNLLMENSAFGTDSERSRLQFCVDIEILEKEYTLTEALYMLSTVNSRSNFSESYSIETLT
DILINENLYDLAFTIVLKFWKDSGMKRELERVFAAIAQQCCPNKVGNSGRDLTGSQQLLL
LPSSQDDAWDDNNKSIAVAHQVRGSCQWETLEIYLDKYTDLHPRLPVIVAETLLYTDPEI
ELPLWLVQMFKTSKGGNRMISWGMSGKEADPAALFRLYINYGRHTEATNLLVQYLDSFAS
SRPVDVLHRKKMSAAWFPYTTIERFWSQLEEMQSAGHSVDQCDKLKKLLHGALMNHLQQV
VVDSEDVLSSVGGGQGTESQSS
Download sequence
Identical sequences I1HX48
XP_010233798.1.954 EG:BRADI3G03637.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]