SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G04040.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G04040.1
Domain Number 1 Region: 287-604
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 2.48e-40
Family Galactose oxidase, central domain 0.014
Further Details:      
 
Domain Number 2 Region: 56-156
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-19
Family Flavin-binding PAS domain 0.0012
Further Details:      
 
Domain Number 3 Region: 200-261
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000288
Family F-box domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G04040.1   Gene: BRADI3G04040   Transcript: BRADI3G04040.1
Sequence length 617
Comment pep:novel chromosome:Brachy1.0:3:2731003:2735728:1 gene:BRADI3G04040 transcript:BRADI3G04040.1
Sequence
MEWDSDSDGGSGDEEEEEEGVGPWGGGGGGGGAGFSLAIEGVLGGACGLVVSDALEPDFP
IIYVNRGFEDATGYHAEEVLGRNCRFLQCRGPFAQRRHPLVDAIVVAEIQRCLEEGTEFQ
GDLLNFRKDGSPFMTNLQLKPIYGDDETITHYMGIQFFNDSNVDLGPLPGSMTKDAVRSI
WIAPDNTHRPSPTGKGNFCSEHSNLFQLSDEVLCQKILSRLSPRDIASVNSVCKRLYHMT
KNDHLWRMVCQNAWGSEATRALENVAGSKSLAWGRIAREMTTLEAVAWRKLTIGGTVEPS
RCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLSASKPEWRHINVGLAPPGRWGHTLSC
LSGSLLVLFGGCGGQGLLNDVFILDLDAKHPTWREILGLAPPVPRSWHSSCTLDGSKLVV
SGGCADSGVLLSDTYLLDVTMERPVWRLIPAPWTPPSRLGHSLSVYDGRKILMFGGLAKS
GPLRLRSGDVFTMDLSEAVPSWRCITGSGMPGACNPAGVGPPPRLDHVAVSLPGGRILIF
GGSVAGLHSASQLYILDPTEEKPTWRILNVPGRPPRFAWGHSTCVMEGTKAIVLGGQTGE
EWTLTEIHELSLTSSLV
Download sequence
Identical sequences I1HXA3
EG:BRADI3G04040.1 15368.BRADI3G04040.1 XP_003574962.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]