SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G07420.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G07420.1
Domain Number 1 Region: 37-157
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000233
Family Ankyrin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G07420.1   Gene: BRADI3G07420   Transcript: BRADI3G07420.1
Sequence length 198
Comment pep:novel chromosome:Brachy1.0:3:5540320:5541818:-1 gene:BRADI3G07420 transcript:BRADI3G07420.1
Sequence
MSATSTEQQELLQKTQIKLRPNLQSKQDEGFKPHPELLMAAQRGLGRMVTHLIALASAVS
DHVDGEKAKEFLRMQNEQGETALHEAVRLGSRDLVDRLMAVDPELARVPPADGASPLYLA
VSLGHFSIAWQLHEKDNALSYSGPDGRSALHAAVLKSEANFMLLSWGNGGGLEEFGGGGG
AHPVTVRLLEVGVHTLQG
Download sequence
Identical sequences I1HYH1
15368.BRADI3G07420.1 EG:BRADI3G07420.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]