SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G08150.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G08150.1
Domain Number 1 Region: 408-682
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.27e-69
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 710-779
Classification Level Classification E-value
Superfamily RING/U-box 2.3e-23
Family U-box 0.0029
Further Details:      
 
Domain Number 3 Region: 23-173
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00000000837
Family Universal stress protein-like 0.045
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G08150.1
Domain Number - Region: 297-380
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0319
Family FCH domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G08150.1   Gene: BRADI3G08150   Transcript: BRADI3G08150.1
Sequence length 787
Comment pep:novel chromosome:Brachy1.0:3:6329566:6333871:1 gene:BRADI3G08150 transcript:BRADI3G08150.1
Sequence
MAASAVHPPPPPPPTVAVAVRPGGSASRRAARWAAAGILQAVDGAAVSIAFVHVIPPLSF
VPSPSGERVPVARVGREAAEAFSRDRHARAQEAMLPFRRLSDRRANITVETVVVEGDGVA
EALLRYAAESGVRSLVLGSASASFRWFHKVLSIPDVATAVLKSTQNSCNVYVVCKRRVIV
KLAGHPQATIHSSFEESSTSLNIHSMSHKEFEETQRSLLFDNFTDAESCSMSCSQARGSH
STSSNASRSSGSRELVHMGSVGAKTTGRDVKQSYGSHSTLKEVPYAASSSSDECQSIDEV
EKLRRELKETLVMYDKACEDLVHAKKKIQVLSTECSEEAKKVEHALHTEETLKQKAADEK
AKHLEAIKEVEQAKWSFTREAYSKHKAEMVGSMMSLDKEKIVDAILSNTRSCRRYSKHEI
ELATDNFSEARKIGEGGYGNVYRCTLDHIEVAVKVIQQDSTDKTDEFLREVEILSKLHHP
NLVLLIGFCPEMGCLVYEYMENGSLEDQLLNNKKRQPLHWFLRFRIIFEVSCGLAFLHGR
KPEPIVHRDLKPANILLDKNYVAKIGDAGFAKLISDLVPDCQTEYTDTIVAGTLYYMDPE
YQQTGTVRPKSDLFGLGVIILQLLTGKRPHGLIVSVENAVKKGLLFHVLDMSQTDWPLAE
AEMLAKLGLQCTALKCRDRPDLDSEVLPKLEEILRRISCKADMRNPKPCAPAHFICPITK
EVMDDPYVVADGHTYEHYAIEAWLRKYRTSPLTRRKLPNLSIIPNHSLRAAIQQWKNSSR
AEAWNGQ
Download sequence
Identical sequences I1HYS1
15368.BRADI3G08150.1 EG:BRADI3G08150.1 XP_010234043.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]