SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G12957.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G12957.1
Domain Number 1 Region: 56-337
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.56e-40
Family Protein kinases, catalytic subunit 0.00073
Further Details:      
 
Domain Number 2 Region: 406-496
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000024
Family Tetratricopeptide repeat (TPR) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G12957.1   Gene: BRADI3G12957   Transcript: BRADI3G12957.1
Sequence length 507
Comment pep:novel chromosome:Brachy1.0:3:11615230:11619940:1 gene:BRADI3G12957 transcript:BRADI3G12957.1
Sequence
MGARPWRLLCCCCCRGESDRNGVADDLRLKPDAAEEFVDGGEGETAAGDWCHDLPPFQEF
SFQQLRLATAGFAAENIVSEHGDKAPNVVYKGKLDAQRKIAVKRFNRAAWPDPRQFLEEA
KSVGQLRSKRFANLLGCCCEGDERLLVSEYMPNNTLAKHLFHWESKAMVGPMRLRVVLYL
AEALDYCISKGRALYHDLNAYRVLFDDDCNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYM
RTGRITPESVIYSFGTLLSDVLSGKHIPPSHALDLIRDRNFSMLIDSCLAGQISNEEGTE
LLRLASRCLHYEPRERPNARSLVLALASLQKDVETPSYDLMDKPRGGAFTLQSIHLSPLA
EACSRKDLTAIHEILEKTGYKDDEGTANELSFQMWTNQMQVTMDSKKKGDNAFRQKDFTV
AIDCYSQFIDVGTMSSPTVYARRCLSHLMNDMPQQALNDAMQALVIFPTWPTAFYLQAAA
LFSLGKENEAREALKDGSAVETRSKDR
Download sequence
Identical sequences I1I087
EG:BRADI3G12957.1 EG:BRADI3G12957.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]