SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G15410.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G15410.1
Domain Number 1 Region: 1693-1841
Classification Level Classification E-value
Superfamily SET domain 3.4e-29
Family Histone lysine methyltransferases 0.075
Further Details:      
 
Domain Number 2 Region: 1064-1108
Classification Level Classification E-value
Superfamily F-box domain 0.00000785
Family F-box domain 0.005
Further Details:      
 
Domain Number 3 Region: 461-513
Classification Level Classification E-value
Superfamily GYF domain 0.0000458
Family GYF domain 0.0066
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G15410.1
Domain Number - Region: 867-902
Classification Level Classification E-value
Superfamily GYF domain 0.00249
Family GYF domain 0.0082
Further Details:      
 
Domain Number - Region: 1119-1195
Classification Level Classification E-value
Superfamily RNI-like 0.00824
Family Cyclin A/CDK2-associated p19, Skp2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G15410.1   Gene: BRADI3G15410   Transcript: BRADI3G15410.1
Sequence length 2243
Comment pep:novel chromosome:Brachy1.0:3:13731787:13742725:-1 gene:BRADI3G15410 transcript:BRADI3G15410.1
Sequence
MPDKGDKGHGHHQHQRQQHQHKQQSTSAPDLEEGEVLLNGEAENKGVSERTVPPKKWRKL
LPASHAAEVEPGEIVGVQPAPARKARRNGELDKGEIVPVRQWKDKPEKIVRKSNTVEPGE
LAPLEKKRDRDHNRKLSSSSQVREDGKKASLRDSDEEPGEIKPESSSSASARKSRAVEPE
SNHRKHHAETCDQSGSKSRRKGEAKSTSAGRHLSGRNHEISTPIRDRHDRLERSPGILGR
FPHDRVRHEKHERSPSRLERSPRDRGRHYDNRDRSPYISPRHKVRQPHHRDSTPSRIDNS
PRGRIQHEDIRDRTPLRTDRSPSERGRTTDSHEASKKSRGAKLESKNLENAQHKNKSMKQ
SCKNKSGSNGKSEERISKEKATESIQYTELPPPPPLLPPPPPPPPPPPPLPPSMPPPLPP
PPVPEQPNDVVVEDVSMEEDMDICDTPPHTSEAPKPSVEPSTVMGKWFYLDQFGVEQGPS
KLADLKKLVDDGYLLSDHLIKHADCNRWVTVENAATPLVPSDISLVYSDGTTQLVSPPEA
PGNLLDEAREEASALASSADNEQMEEASEEPKEDLYIDNRVGALMYGSVLVEGHELEILG
DALATHFNRVDLERWDQPEDFPRFQAQPAREDVINGGIEFADNSATDIYGVGPIERDTFY
HNVESSEWFSGRWSCKGGDWKRNDEFSQDKPYRKKLVLNEGYALCQMPKGSHEDPRWHCK
DDLYYHVPAKKLDLPLWAFSSTEESTDTVDDTSKGGIMPGRSGQVRQSTKGVKGMTLPVV
RINARVVKDQSSVEPCIKPRGADRSLSRSSRSHSIGADRSSAHEGLSYSKKHHEHDLQSF
HKSKSVLNIPEDHVCTVEELSVKLGDWYYLDGTAHEHGPFSYSELQKLVRRGTIRERSSV
FRKIDNTWLPVVKDMKFDSASRNGGSGSSNSTSALVHSDQSNVVVNHGSGSFHELHPQFV
GYTRGKLHELVMKYFKSRELTLAINEVLDPWIAAKQPKKEIETYVANNSATRNLLPEDAG
SAKRARFLPDRSDEDIDMYEDILTSHKDDCCFEDLFQEAALTNSIAESESWDLLNGHVLA
RIFHFLRADMKSLISSAATCRRWNTAAKCYRNTCRFVDLSSVGPRCTDSVFRGIMAGYEK
QNIKTLVLVGCSSLSPLALEKVLVQLPHISYVHIQGCSQLEDMKSRFQHIKWITSSLNPE
ESLQKIKSLKQIDDGSGHPSKVARNMTSQLGGSDELDGYFADISNRENANLSFGQGFYKR
SKWLDARKSSAVLSKDAQLRRLMQRNAENSYRKMEEFVISRLREIMKSSRFDFFDPKVEK
IEARLRSGYYARHGFSSLKDDIRSMCRDALRSKGRSEDMKQIVVSFIQLAKRLGNPRVIS
ERNGAVIQKDNSDMVQYTSDTKLKKKQNKTTGERRGANWTAATAGADTSSRAFDREIKRS
LSKLKKRDVDSGSETSDDDDGYSEGDETESETTVSDTESDLDLNSVAWDLKGNGMKLFES
GDSVTDDRGWGARMTKASLVPPVTRKYEVIEKYLIVADEEEVQRKMRVALPDDYSEKLLS
QKNGTENLEIPEVKEYQRRKVPGDEILEQEVYGIDPFTHNLLRDIMPADLGWSAADQHTF
IEELLLNTLNKQVKDFTGSGNTPMVYHLKPVIEEIQKSAEESGDRRTVKMCLGMLKAMRS
RPGPDHKHYVAYRKGLGVVCNKKGGFGVDDFVIEFFGEVYPSWRWYEKQDGIKHIQNNSE
DQAPEFYNIMLERPKGDRDGYDLVFVDAMHKANYASRICHSCNPNCEAKVTAVDGQYQIG
VYTVRPIAEGEEITFDYNSVTESKEEHEASVCLCGSQVCRGSYLNFSGEGAFEKVLMEFH
GVLDRHSLLLQACEANSVSQQDLIDLGRAGLGTCLLAGLPGWLVAYTAHLVRFIFFERQK
LPNEIFKHNVDEKRQFFTDINMDSERNDAEVQAEGVLNSRLQNLTHTLDKVRYVMRCVFG
DPKNAPPPLVRLTGRSLVSAIWKGEGSLVEELLQSMEPHVEEDVLADLKDKIRDHDPSDS
EDIEGDIRNSLLWLRDELRSLSCTYKCRHDAAADLIHMYAYTKCFFRARDYKTVKSPPVH
ISPLDLGPKYADKLGPGFQEYRKTYPENYCLAQLIYWYSQNAEPESRLTRARKGCMSLPD
VSSFYVTSVKQTQERVYGTRTVRFMLTRMEKQAQRQWPKDRIWVFKNHPRFFGTPMMDAV
LNNSSLDKEMVHWLKTRSNVFLG
Download sequence
Identical sequences I1I126
15368.BRADI3G15410.1 EG:BRADI3G15410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]