SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G18560.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G18560.1
Domain Number 1 Region: 202-417
Classification Level Classification E-value
Superfamily Kelch motif 5.1e-34
Family Kelch motif 0.023
Further Details:      
 
Domain Number 2 Region: 94-188
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000000379
Family Kelch motif 0.04
Further Details:      
 
Domain Number 3 Region: 6-77
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000392
Family F-box domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G18560.1   Gene: BRADI3G18560   Transcript: BRADI3G18560.1
Sequence length 444
Comment pep:novel chromosome:Brachy1.0:3:17040924:17045863:-1 gene:BRADI3G18560 transcript:BRADI3G18560.1
Sequence
MEAAAPVEHLGYDQVLSILRRLPAEAVLSFAATCRAFRAWASSDVLWEALFRRDCGGRAA
AALAERRRDRPWRRVYADVARLGALSARRLRVKGVSPRPRASHSLNLVAGWLVVFGGGCE
GGRHLDDIWATYVGNGAGNRLSNILNWQQLASGTPSGRFGHSCILVGDALVLFGGINDRG
LRLNDTWIGQIICEEPCRMRISWRLLEVGPLAPSPRGAHAACCVDDKFIVIHGGIGLNGS
RLGDTWLLDISGGLQSGSWRQMGDTGPLPSPRSGHTLTWIGETRMVLFGGRGSEYDVLND
VWLFDIGHHFPRWKELKYDLSSVLGELPFPRVGHSATHLLGSKILVYGGEDSQRRRMDDF
WILDVPALLQFESGSRKMAKRMWKKLRIDGQSPNCRSFHGACVDTSDCRVYVFGGMVDAL
IHPAESLGLRFDGQLYQVELVLHL
Download sequence
Identical sequences I1I254
XP_003573580.1.954 EG:BRADI3G18560.1 15368.BRADI3G18560.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]