SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G19170.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G19170.1
Domain Number 1 Region: 20-277
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.15e-49
Family Ankyrin repeat 0.00038
Further Details:      
 
Domain Number 2 Region: 317-378
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000883
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G19170.1   Gene: BRADI3G19170   Transcript: BRADI3G19170.1
Sequence length 485
Comment pep:novel chromosome:Brachy1.0:3:17814450:17820337:-1 gene:BRADI3G19170 transcript:BRADI3G19170.1
Sequence
MGILGMMGDSFGCSATGERLVSAARDGDIQEARALLELNPRLARYSTFGIRNSPLHYSAA
KGHHEIVSLLIESGVDINLRNCRGQTALMQACLYGHWKVVQILVLFKANIHKKDCFSGAS
AIHFAALKGHTRCIRLLVADYVPSMPNFWNIMHGLSTEERNKEAYDAGTLRRLLNGKSDG
GVTPLHLAALHGHAESLQLLLDLGASVSEVTVNDGSTIDLIGSGSTPLHYAACGGSAVCC
QLLIAAGANMAAENANGLTPLMVARSWHKTSIESILSKQPEGRLRILPSPYLSLPLMSIV
KIARECGWRKTSVSSTCHDPCVICLEMECTVAAEGCGHEFCTKCALYLCSTTSSSTSIRG
VPGSISCPLCRQAIVSFMKLTSTTPIKELPWTSSSLALCAAGASTTGSKCPSSLHRRSDM
NRLRSSSVHLGCSSFRSIGSGKLSSIKLNCGGLDETMPCLVSCLRPDARRSSSYRERISR
YSEFS
Download sequence
Identical sequences I1I2D0
15368.BRADI3G19170.1 EG:BRADI3G19170.1 XP_003573619.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]