SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G19170.4 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G19170.4
Domain Number 1 Region: 20-277
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.44e-49
Family Ankyrin repeat 0.00038
Further Details:      
 
Domain Number 2 Region: 317-375
Classification Level Classification E-value
Superfamily RING/U-box 0.00000459
Family RING finger domain, C3HC4 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G19170.4   Gene: BRADI3G19170   Transcript: BRADI3G19170.4
Sequence length 453
Comment pep:novel chromosome:Brachy1.0:3:17814450:17820337:-1 gene:BRADI3G19170 transcript:BRADI3G19170.4
Sequence
MGILGMMGDSFGCSATGERLVSAARDGDIQEARALLELNPRLARYSTFGIRNSPLHYSAA
KGHHEIVSLLIESGVDINLRNCRGQTALMQACLYGHWKVVQILVLFKANIHKKDCFSGAS
AIHFAALKGHTRCIRLLVADYVPSMPNFWNIMHGLSTEERNKEAYDAGTLRRLLNGKSDG
GVTPLHLAALHGHAESLQLLLDLGASVSEVTVNDGSTIDLIGSGSTPLHYAACGGSAVCC
QLLIAAGANMAAENANGLTPLMVARSWHKTSIESILSKQPEGRLRILPSPYLSLPLMSIV
KIARECGWRKTSVSSTCHDPCVICLEMECTVAAEGCGHEFCTKCALYLCSTTSSSTSIRG
VPGSISCPLCASTTGSKCPSSLHRRSDMNRLRSSSVHLGCSSFRSIGSGKLSSIKLNCGG
LDETMPCLVSCLRPDARRSSSYRERISRYSEFS
Download sequence
Identical sequences I1I2D2
EG:BRADI3G19170.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]