SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G19385.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G19385.1
Domain Number 1 Region: 175-300,405-524
Classification Level Classification E-value
Superfamily L domain-like 0.0000000017
Family Ngr ectodomain-like 0.074
Further Details:      
 
Domain Number 2 Region: 83-125
Classification Level Classification E-value
Superfamily F-box domain 0.000000111
Family F-box domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G19385.1   Gene: BRADI3G19385   Transcript: BRADI3G19385.1
Sequence length 584
Comment pep:novel chromosome:Brachy1.0:3:18119478:18124886:-1 gene:BRADI3G19385 transcript:BRADI3G19385.1
Sequence
ARQKTPKKHFIKQYIYAFRDVSGTYNQQHGRRRHSGRLETRKFATEKMASTSSTSSSSSP
RQMEEEEPVAARNDRSSPPDMLDNIPPLPLDVLDNIFARLPFEQLVLTSRLSRDWRRRWE
PFPNLDIWFTPGIFPKPDVGTLERCAAPVRSFTARVGTPHYHRIGGWLHALARKRLENLI
LRFDDQLQRAVLGPGLFSCRALARLELHGFCDMPRAPPQGFGGFPNLVTLVLIDVTLPFV
GGGAQLERLISSAPQLRVLTLDNVEETWTIRAPNLRVLKFITDIDNGCRFTEDLPLLEEA
AICIDDPIEFVAQDLIETLRRIASVKRLLFDANTVQTEKITTRKHEADEDFSFPNLDIWF
TPGIFPKPDVGTLERWAAPVRSFTARVGTPHYHRIAGWLHALARKRVEKLILRFGDPFEC
AVLAPGLFSCRALTRLELHGFCLMPRAPPQGFGGFPNLATLVLIDVISLFVGCGAQLERL
ISTAPQLRVLTLDSVMVTASHTDADAVEETWTIRAPNLRVLKFSMDMDNGCRFTEELPLL
EEAFITIEDPIEFGTQDLIIDSLRRITSVKRLSFDADTVQAMFF
Download sequence
Identical sequences I1I2F7
EG:BRADI3G19385.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]