SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G29170.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G29170.1
Domain Number 1 Region: 14-84
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000301
Family F-box domain 0.0094
Further Details:      
 
Domain Number 2 Region: 329-379
Classification Level Classification E-value
Superfamily F-box domain 0.000000183
Family F-box domain 0.0074
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G29170.1
Domain Number - Region: 253-308,452-561
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0255
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 
Domain Number - Region: 257-309
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0369
Family Quinoprotein alcohol dehydrogenase-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G29170.1   Gene: BRADI3G29170   Transcript: BRADI3G29170.1
Sequence length 596
Comment pep:novel chromosome:Brachy1.0:3:31090787:31094486:-1 gene:BRADI3G29170 transcript:BRADI3G29170.1
Sequence
MEPSEATTAEENQDATPLPKEMLNEILARLPAKSVGRSRCVSPEWAALLSSAHFVDLHAR
RANRSDCPRLLLAPVGSLYDDYIYSWQPGGQVEKLMPDDFAAKGLLAPVTKPCHGLVLIR
CTDYGGCEVLVLDTPAYWRPAAQESPLCYVNEEKPAVFLNGHLHYLCRDAEIITFNTSSE
TFGSLLPPTGFENASPVLTELDSCLCFCYGEPDSDDPYHVFLLKDYMEGRWDKLCCIDRI
AWPETERMLLRSLCISPLGMYHSGDGQRKIMFGTGSCKVFAVDIDSNTPEILFTPDGTII
GSCEDDYTLPLCVFEEYLGPVGRTLEEMIFSSLTTKAWSDILKWMSARSVSELSLVCREW
RAMIMTDRFIQSHVIHANLNKNPRIMIVVDARFGHYMNMKDFFDAGAPALYANLHIESVD
DDVPLFAGRIGLGYDSEINKHVLVHTTYKEKNLDTCEIVAFNVATDEFEVLQGPPCSHDN
GRISILQLQGALCVACSDKSMNVLDIWMMKDIDTWLMEYHIELNEFLPEYLSENTTPLLV
DPKDGRILLNTGLSLGYYDPKMLGLETIYTAGMPEHDARFWPIICDESLLCPLGPS
Download sequence
Identical sequences I1I4U3
15368.BRADI3G29170.1 EG:BRADI3G29170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]