SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G31460.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G31460.1
Domain Number 1 Region: 14-134,168-283
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.95e-50
Family Ankyrin repeat 0.00027
Further Details:      
 
Domain Number 2 Region: 322-383
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000482
Family RING finger domain, C3HC4 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G31460.1   Gene: BRADI3G31460   Transcript: BRADI3G31460.1
Sequence length 520
Comment pep:novel chromosome:Brachy1.0:3:33607580:33612312:-1 gene:BRADI3G31460 transcript:BRADI3G31460.1
Sequence
MGNSLGCSASGERLVSAARDGDAVEARMLLELSPALARYSTFGGLNSPLHFAAAKGHLDI
VTMLLEKGADVNARNYCGQTALMHACRHGHWEVVQMLLLFRCNVTRADYLSGRTALHFAA
HDGLVRCVRLLLADFVPSSSLEDSASSVADGGDCQTISGSSPNSSLGLKFNEQARARYIN
KPADGGVTALHMAALNGHLDCMQLLIELGANVSAVTFPYGTTSNLIGAGSTPLHYAAGGG
NQECCQLLLAKGASRLTLNCNGWLPLDVARIFGRRSLEPLLSPNSHSIIPVIQPSSYLAL
PLMSILNIAREFGLQHTISSVDDSDLCAVCLERSCSVAAEGCGHEFCIKCALYLCSTSHV
CVEFTGPPGSIPCPLCRSGIMSFTKLPGTPTEGLKSSSALTFCNPCILNTRSVDSPATVC
KAEIRRNRVAAVSSELVCPLTCSPFPSSALPTCRCSDDDPCGSTETQDGSEVQSPRPSHS
ASTEMDKSSEQDLDQTTCSGMFWSRRSCQREQQCNAEINA
Download sequence
Identical sequences I1I5I0
15368.BRADI3G31460.1 EG:BRADI3G31460.1 XP_003574216.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]