SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G32800.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G32800.1
Domain Number 1 Region: 437-698
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-41
Family Protein kinases, catalytic subunit 0.00094
Further Details:      
 
Domain Number 2 Region: 729-802
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-22
Family U-box 0.0016
Further Details:      
 
Domain Number 3 Region: 54-163
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000000218
Family Universal stress protein-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G32800.1   Gene: BRADI3G32800   Transcript: BRADI3G32800.1
Sequence length 813
Comment pep:novel chromosome:Brachy1.0:3:35200578:35203882:1 gene:BRADI3G32800 transcript:BRADI3G32800.1
Sequence
MEAAAASPRSTSTTTGGNGMTAASAEALEEEEEEEQQSVMKVFVALPEKYKSGRSTVAWA
LRHLAAGSAVVVVVVAHVHSPAQMIPILGSKFQASKLRPEEVDAYRQYERGKVNKHLDEY
IRQCTKMKIKVEKLVIEHEDVAEGIVQLVSKHNVGKLVMGAAADKYFSRSRKMEAPRSKK
ALAVMQNADPACKIWFVCKEHLIYTREVGDTRKIPTPTPSARYSVQPSRYAKMAVAGCMK
MQRSMSEKALPLRPSSSSSSSRPAAARRALSVLCLEEDLSVGSWDSVPEEILPSSCRGEA
SSSDDDDDDESSSFEVPLDEALAAILPISSTVPGHHQQVAKFFEDLCSDEAARKTKGGGV
KEEAALAKEEVRVLKEEMEALKRDRDAAVGELSEQKAELEQRVAELEDAAASEAILEEEE
EEEEEEEGVDGLAWRAAEFSLVELRLATGNFGDAAKVSDGVYRGVLRSATVAIKLLPCRS
PQGPPQFPRQVRALSRVRHPNLVTPIGLCPKPPALVYEYLPNGTLEDRLATSPPLTWHAR
TRIIGEICAALVSLHSAQPRPVIHGDVNPSNVLLNADLDTTCQLADAGGLVSSRLLLTAT
PSMAAAYADPELQGGEPTASSDVYAFGVLVLRLVTGAPPLGVAGKVEEALERGEMEEAVD
RTAGEWPFAQAEKLMLLGLQCAEASARKRPDRMSQVWRVVGPLVKAAAAMPVPAPAAESP
AGCLFGETHAPLYFTCPISQEVMRNPHMAADGFTYEAEAIKGWLDSGHDTSPMTKLALPH
RHVTPNYALRSAIEDYMKKQQQHTTASQSVRSN
Download sequence
Identical sequences I1I5Y9
15368.BRADI3G32800.1 EG:BRADI3G32800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]