SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G34457.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G34457.1
Domain Number 1 Region: 775-1063
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.63e-74
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 68-436
Classification Level Classification E-value
Superfamily RNI-like 5.96e-65
Family Cyclin A/CDK2-associated p19, Skp2 0.032
Further Details:      
 
Domain Number 3 Region: 377-703
Classification Level Classification E-value
Superfamily L domain-like 3.97e-47
Family Polygalacturonase inhibiting protein PGIP 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G34457.1   Gene: BRADI3G34457   Transcript: BRADI3G34457.1
Sequence length 1109
Comment pep:novel chromosome:Brachy1.0:3:36852132:36856125:1 gene:BRADI3G34457 transcript:BRADI3G34457.1
Sequence
MGLILWHWLLFFFNLMSLCCSLSSDGLALLALSKRLILPDMIRSNWSSHDTTPCEWKGVQ
CKMNNVAHLNLSYYGVSGSIGPEIGRIKYLEQLDLSSNHISGLIPPELGNCTVLTLLDLS
NNSLSGVIPASFMNLKKLSQLALYSNSLGGEIPEGLFKNQFLERVFLDNNKLNGSIPSSV
GEMTGLRYFRLNGNMLSGVLPDSIGNCTKLVNLYLYDNKLNGSLPKSLSNMEGLIFLDVS
NNGFTGDISFKFKNCKLEDFVLSSNQISGKIPEWLGNCSSLTTLGFYNNRFSGQIPTSIG
LLRNISVLILTQNSLTGPIPLEIGNCRSLVWLQLGANQLEGTVPKQLAKLNKLERLFLFE
NHLTGEFPQDIWGIQSLEYVLLYRNNLSGRLPPMLAELKHLQFVKLLDNLFTGVIPPGFG
MNSPLVEIDFTNNSFVGGIPPNICSGNRLEVLNLGNNFLNGTIPSNVANCSSLIRVRLQN
NSLNGQVPQFGHCAHLNFTDLSHNFLSGDIPASLGRCVKMTYIDWSRNKLAGPIPTELGQ
LVKLESLDLSHNSLNGSALIILCSLRYMSKLRLQENKFSGGIPDCISQLNMLIELQLGGN
VLGGNIPSSVGSLKKLSIALNLSSNSLMGDIPSQLGNLVDLASLDLSFNNLSGGLDSLRS
LGSLYALNLSFNKFSGPVPENLLQFLNSTSSPLNGNSGLCISCHDGDSSCKGVNVLKLCS
QSSKRGVLGRVKIAVICLGSVLVGALLILCIFLKYRCSKTKVEGGLAKFLSESSSKLIEV
IESTENFDDKYIIGTGGHGTVYKATLRSGEVYAVKKLVSGATKILNASMIREMNTLGHIR
HRNLVKLKDFLLKREYGLILYEFMEKGSLHDVLHGTEQAPVLEWSIRYNIALGTAHGLAY
LHNDCQPAIIHRDIKPKNILLDKDMVPHISDFGIAKIIDQSPAAPQTTGIVGTIGYMAPE
MAFSTRSTIEFDVYSYGVVLLELITRKMALDPSFPDNLDLVSWVSSTLNEGNIVETVSDP
ALMREVCGTAELEEVRGVLSIALKCIAKDPRQRPSMVDVVKELTHSRRDDLSLSKQEISG
SSSSLRNQAPSCFVPAVPVNRDNSVTNSS
Download sequence
Identical sequences I1I6I6
XP_010235055.1.954 XP_014755550.1.954 XP_014755551.1.954 EG:BRADI3G34457.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]