SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G40437.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G40437.2
Domain Number 1 Region: 118-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-42
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 977-1052
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000017
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G40437.2   Gene: BRADI3G40437   Transcript: BRADI3G40437.2
Sequence length 1086
Comment pep:novel chromosome:Brachy1.0:3:42639513:42645777:1 gene:BRADI3G40437 transcript:BRADI3G40437.2
Sequence
MMSAPESSCGGDEEAGMRRSKVNQELWYACAGPLVALPPAGSLVVYFPQGHSEQVAASMR
KDADAQIPSYPNLPSKLICILHNVTMEADPDTDEVYARMTLQPVTQCDKEILLASEIALK
QSRPQTEFFCKTLTASDTSTHGGFSVPRRAAERIFPQLDFSLQPPAQELQARDLHDNTWT
FRHIFRGQPKRHLLTTGWSLFISGKRLLAGDSVLFIRDGKHQLLLGIRRANRQPTNLSSS
VLSSDSMHIGVLAAAAHAAANNSQFTIFYNPRASPSEFVIPFAKYQKAVYSNQLSLGMRF
RMMFETEESGTRRYMGTITGISDLDPVRWKSSQWRSIQVAWDEAAPTERRTRVSLWEIEP
VIAPFFIYPSPLFTAKRARQPGMIDDETSEMDNLFKRTMPWLGEDICKKDLNSQNSIAPG
LNLVQSLQWMNMQQNLSLAGTGMQPELLNSLASKHVQNLSAADISRQISFQPQFLQQNNI
QFNTSLLPQQNQQNEQLAKVIAPNQLGNIMVPQKVDQDRNSDQKQHVVTQSLPGGQASIN
ITRPQLVAQAQFQQPQVILQAQVQQQQPLVQSHTVLHGGLQQIQLLPQQQPHLQKQQQSQ
HHQQVQHLVQEQQHIKVQPLQVSSDVNMNMQLSDNQMKLQLLKALQSQQHLTLEQQKMFF
DLQQQMVNCQSDPQQCTQGATQTVGIHNTIQYTTQQNSQPHQPVQDSPGNSIPIAKTDII
TSMGASSLSTVGGMQSLKTHNGPSSSTSPCTNTNPVLLQSIPSSSKNQSSLTAAKTSQSS
VMLGPTIEQEMKSYQSVKPTMIIPKMTEQRPTTGQDCLNNNPHIDYLDTSSSATSVCLSQ
ADGSFQQNFPPSSLNQHQLLRDTVPDNEFEVTDPRNNLLFGVNIDGQLGLPLNADALLAT
SIENDKFMDQMAGNGISNYMSSKESQQEISSSMISHSFGVADMAFNSIDSAINDTPFLNR
NSRAPAPAHQRMRTYTKVHKRGAVGRSIDINRYSGYDELKHDIARMFGIEGQLGDQSRVG
WKLVYEDHEKDVLLVGDDPWEDFLNCVRCIRILSPQEEMQMRLVGDIGDGFLPNQACSSS
DGGQPW
Download sequence
Identical sequences I1I8M5
EG:BRADI3G40437.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]