SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G42000.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G42000.1
Domain Number 1 Region: 224-409
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000000000000548
Family Cystathionine synthase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G42000.1   Gene: BRADI3G42000   Transcript: BRADI3G42000.1
Sequence length 689
Comment pep:novel chromosome:Brachy1.0:3:43785117:43787446:1 gene:BRADI3G42000 transcript:BRADI3G42000.1
Sequence
MLFLIAKYLSSSSSRRRGSSKHTAAAPGDNNREMPAAAAVEREREQGCMAGCVPVAMRYK
RTGASAKVVTVTASSARTSRHGFVRSAASGLFRDGAAARGRYFTNHESLPPLPEARAEFA
AAFPQYSAGAGDGEEAAAAADAIRAREYPHLARHACLDYTGVNLFSHAQMDSSSSSLPST
SSSSPAPAPWQPPFFDVAYRSATLRSQVEQCDSGGIGGGIGRAVARRIMASMKMPEEEYV
MVCAANRTSAFRLLAESYAFSSPNSGGRKKKKLLAVYDYESEAVGAMSAAARRRGAEVLH
ATFTWPGLRLHAADLRKKLLRRHQGLMVFPLVSRMTGARHPYLWMSAAAERGWHVALDAS
AMGAKDLDTLGLSLLRPDFVVCNFFKVFGENPSGFAGIFVKKASLAALVEDSPAAVARSI
GVVSLVPPRRWSLRDDYSTDLDLSRSFTNPDPPPPQSAEIDITCSFSGPLSTAAAAATPE
ICEEEEAPAPPPPPPLPEAEEKEVAVELRGLDHADALGLIAIGNRLRCISNWLVIAMQKL
KHPHPEDTAAIGGGGGQQLVRIYGPRVSFSRGPAVAFNVYDWKGEKVAPGMVQKLADRHA
VSLTCGFLRNVSFADKYDADRTAVLERRRSNEGEEEVWGIHVVNASLGFLSSFEDAYRLW
AFVAKFLDADFVEKERWRYTALNQKTVEV
Download sequence
Identical sequences I1I968
XP_003574874.2.954 15368.BRADI3G42000.1 EG:BRADI3G42000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]