SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G48760.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G48760.1
Domain Number 1 Region: 671-992
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-69
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 358-616
Classification Level Classification E-value
Superfamily L domain-like 5.21e-58
Family Polygalacturonase inhibiting protein PGIP 0.0021
Further Details:      
 
Domain Number 3 Region: 51-346
Classification Level Classification E-value
Superfamily L domain-like 2.49e-55
Family Polygalacturonase inhibiting protein PGIP 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G48760.1   Gene: BRADI3G48760   Transcript: BRADI3G48760.1
Sequence length 1014
Comment pep:novel chromosome:Brachy1.0:3:50147390:50150984:1 gene:BRADI3G48760 transcript:BRADI3G48760.1
Sequence
MASCALLPPSRGNTGLMSDQPVKLKMLVLLAFLLLSYGAGDVQCATVHANITDILSLLHF
KKVTNDPTQALKSWNRSTHYCNWNGVMCDPSYPGRVVGLLLGGQRLSGQITLSLGNITFL
QYLNLSHNGFSGQLPSLNQFHELVLLDLHSNSLRGMIIPDSLVNCSNLRVLDLSKNMLEG
PIPAEIGSLYSLRAVDFSYNNLNGVIPPTFSNATQLLLLSAQENQLVGSIPGELGKLSNM
LTLGFGGNSLSGPIPPPIFNLTSLQVLDGYFNMLEMELPLDIGDTLPKLQSLTLGGSMLK
GPIPASLGNASGLQVIDLGHNSFVGEIPDFGKLLNLTQLILESNKLEIRNGQSWESFYGL
TNCRSLEMLLLGNNQLQGAIPDLIGNFSTEFAHLQLNGNDLSGIVPPSLGNLGGLIDLSL
SNNSLFGSIEGWVTSLKNLQSLDLEGNSFVGSIPPSFGNLSKLTLLSLAKNEFEGPIHPI
LGELTRLSSMDLSYNNLQGEIPPEISGLKELRMLNLSSNKLTGEIPNDLSQCQSLATIQM
DHNNLTGHIPTSFGDLMSLTTLSLSHNDLSGTVPASLQPLSKLDLSYNQLQGVIPTKGVF
GNASAVSLGGNSGLCGGVPELHMPSCPAASQRNKIRYYLIRVLIPIFGFMSLILLVYFLL
LERKMSRRTYESHAPLGEHFPKVSYNDLVEATWNFSDANLIGKGSYGTVYKGKLVQNKME
VAVKVFDLEMRGAERSFMSECEALRSIQHRNLLSIITACSTVDSNGNPFRALIYDFMPKG
NLDMWLHHKGDEKNKGDDNAHKNLTLTQRISIAVNIADALDYLHNDSENPIIHCDVKPSN
ILLDDDMVAHLGDFGIARVFLDSRPRPAGSTSSIGVKGTIGYIPPEYAGGARISISGDVY
SFGIVLLEMLTGKRPTDPIFKDGLDIVNFVCSNFPQQIPDVIDVHLKEECKEFAEASVVS
EDPVHQCLVSLLQVALSCTRPLPNERANMRETASKIQAIKASYIERKEKKNISL
Download sequence
Identical sequences I1IBK9
EG:BRADI3G48760.1 XP_010235702.1.954 15368.BRADI3G48760.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]