SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G53760.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G53760.1
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.17e-19
Family Canonical RBD 0.0019
Further Details:      
 
Domain Number 2 Region: 89-112
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000912
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G53760.1   Gene: BRADI3G53760   Transcript: BRADI3G53760.1
Sequence length 194
Comment pep:novel chromosome:Brachy1.0:3:54363824:54367664:-1 gene:BRADI3G53760 transcript:BRADI3G53760.1
Sequence
MARLYVGNLDARVTAGELEDEFRVFGALRSVWVARKPPGFAFIDFDDKRDAEDALRDLDG
KNGWRVELSRNSSGRGGGRDGGGGGRDRHGGSESKCYECGESGHFARECRLRIGAGGLGS
GRRRSRSRSRSPRNRRSPSYGRRSYSPRDRSPRRRSVSPARGRSYSKSPTYNRGRDDSPD
AKGNDGTRYRRSRS
Download sequence
Identical sequences I1IDC3
15368.BRADI3G53760.3 XP_010235900.1.954 EG:BRADI3G53760.1 EG:BRADI3G53760.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]