SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G53810.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G53810.1
Domain Number 1 Region: 20-277
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.18e-50
Family Ankyrin repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 320-374
Classification Level Classification E-value
Superfamily RING/U-box 0.000000835
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G53810.1   Gene: BRADI3G53810   Transcript: BRADI3G53810.1
Sequence length 492
Comment pep:novel chromosome:Brachy1.0:3:54416744:54420597:1 gene:BRADI3G53810 transcript:BRADI3G53810.1
Sequence
MGFLSLVGNSFGCSASGERLVSAARDGDLQEARALLEYNPRLARYSTFGGRNSPLHYAAA
QGHHEIVSLLLESGVEINLRNYGGQTALMQACQYGHWEVVQTLMLFNANTHRTDYLNGGT
ALHFAALHGHAQCLRLVLADYVPSIPNFLNLMNDRSSEEVTDAVFDDDDLVKMVNWKADG
GLTPLHMAALNGHVECVQLLLDLGACVSEVTIEDGTTMDLIGSGSTPLHYAACGGNAVCC
QLLIARGANLAAQNASGLTPLMVAHSWHRNSLEEILSNEPEGRLHTLPSPYLCLPLMSIM
SIARECGWRYRNQSPVCIDPCAVCLEGRCSVAAEGCKHEFCTRCALYLCSTSYTSVNPAG
AIPCPLCRHPIIAFAALPGTSPIRELPRNSLSLSLCTTCPAVNSDSSAASVPSHLYRTEF
HCARMPPMGSSSFRSLSCQRLNPSFCMGTMDTNPCLIRCSRFGSILSRSASHGETNRRPW
PLTFSPIVATTS
Download sequence
Identical sequences I1IDC9
EG:BRADI3G53810.1 XP_014755470.1.954 15368.BRADI3G53810.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]