SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G55007.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G55007.1
Domain Number 1 Region: 351-459
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000178
Family F-box domain 0.0059
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G55007.1
Domain Number - Region: 50-90
Classification Level Classification E-value
Superfamily F-box domain 0.00144
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G55007.1   Gene: BRADI3G55007   Transcript: BRADI3G55007.1
Sequence length 539
Comment pep:novel chromosome:Brachy1.0:3:55389286:55396296:1 gene:BRADI3G55007 transcript:BRADI3G55007.1
Sequence
MQLDRATGAEWFALSASGMQIARRRHRRRKRARSIGCRRSSWSTCYPLTSPACACRVAAV
SRAFRAAAYSDALWSRDLPQFAKGEFPRRTLLFWTKKSLFRRLSEQPTYLPGKLIRMQLD
RATGVQCFAISARAMQIWWPKERPWSYVHWYPVLCSCGCIEGGHRRFQGVVLHCVHRLDV
RAKFPRKLLSQDTTYAAYMLFKHRTSYKLKHLTHLELEASVGVAGSESTRRVALRGYVDD
RPGYRIGQPSSREYVLPSHAAICPGKGDIVFPRKRDGDDWLEVELGEFHNEKGDDSGEVS
MSVVDTVEGRYRGKETWKRRLPRARSIGCRRSSWCTCYPSRRRWPPAAPQPSPASCEIAR
LPDDLLATIITLTSPRDACRAAAVSRAFRAAADSDDVWSRFLPRDLPRFVDSTEISLSMT
PSSKKERFLRLSDHPALLLGRVTSMWLDKFTGGKCYTLSARALDISSAGDEPDNWRWTHA
DVLRDVKTGESQEFRIRGIVENSRFSFQLNPFVCLCFRLIDGEGSSLVRKNNVQILVSI
Download sequence
Identical sequences I1IDS4
EG:BRADI3G55007.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]