SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G59200.5 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G59200.5
Domain Number 1 Region: 106-257
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-26
Family WD40-repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 500-764
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00000824
Family DPP6 N-terminal domain-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G59200.5   Gene: BRADI3G59200   Transcript: BRADI3G59200.5
Sequence length 799
Comment pep:novel chromosome:Brachy1.0:3:58431157:58440552:1 gene:BRADI3G59200 transcript:BRADI3G59200.5
Sequence
MTEMAENWIEGSKHTSAPASFSGSVPRYQTSSPRKSRQRNIFHLLSHREVSPRTKHQAKR
HWSKPPTGDTGFTELRYSASDAKHDLFSWAESQSLHRWSAKYCPLQPPPRSTIAAAFSSD
GKTLASTHGDHTVKIIDCQTGKCLKVLGGHRRTPWVVRYHPLHSDILASGSLDYEVRLWD
ANTSDCIVSHDFHRPIASIAFHALGDILAVASGHKLFIWKYNNREEVSAPSIILRTRRSL
RAVHFHPHGAPYLLTAEVNNLDAADSQLTRATSTGYANYPPALFFANVNSRGYPHLESSM
SSPCLIWPAFLRDDGSLYIPRGDLASSSTNVQQSSPSLAQNLLASDAENQQSDQFVTPMD
ICPGEPSASNDIVDNSSAAGLSAIQMHADRGQTDSRLQGSSSSSSLERSSARDDVPMAST
STSVPIPAIARPSGPAVNRLPTNSFTTSSGLDVQMFLRNSEGGNHHHDLFSDSRSWELPF
LHGWLMAQNHTGVPSSLPIATGSTRGSNRRYDSRPHAFSSVPGVGSSLLGPQIDEAEAHV
ASLGVGSELTTSLFAAGAAELPCTVKLRVWRHDIKNPCSALETAACCLTISHAVLCSEMG
AHFSPCGRFLVACVACMLPQTEGDQGSQLPVQYDSTGPGTSPTRHPLPSHGVIYELRVYS
LEEATFGEILTSRAIRAAHCLTSIQFSPTSEHILLAYGRRHSSLLRSIIMDGETTGIPVY
TILEVYRVSDMELIRVLPSAEDEVNVACFHPSPGGGLVYGTKEGKLRILQHNGADAASLG
LNCFIEENMLEVQRYALEG
Download sequence
Identical sequences I1IF85
EG:BRADI3G59200.3 EG:BRADI3G59200.5 XP_010236113.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]