SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G01400.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G01400.2
Domain Number 1 Region: 19-303
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.19e-54
Family Cell cycle arrest protein BUB3 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G01400.2   Gene: BRADI4G01400   Transcript: BRADI4G01400.2
Sequence length 343
Comment pep:novel chromosome:Brachy1.0:4:899034:904414:-1 gene:BRADI4G01400 transcript:BRADI4G01400.2
Sequence
MANLTSLTSNPNPNKSFEVLPNPGDSLSSLSFSPKSNLLVATSWDNQVRCWEIVGSNSQP
KASISHDQPVLCSAWKDDGTTVFSGGCDKQVKMWPLLSGGQAQTVAMHDGPVKEIAWIPQ
MSLLVSGSWDKTLRYWDTRQQNPAHVQQLPERCYALSVNYPLMIVGTADRHIVIFDLRNP
QAEFKRIQSPLKYQTRCVAAFPDQQGFLVGSIEGRVGVHHIDDAQQSKNFTFKCHREGND
IFSVNSLNFHPVHHTFATAGSDGAFNFWDKDSKQRLKAFSRCPLPIPCSTFNMDGSIFAY
GVCYDWSRGAENHNPTNAKTSIYLHSPQEAEVKGKPRIATGRK
Download sequence
Identical sequences I1IGC0
EG:BRADI4G01400.2 EG:BRADI4G01400.3 XP_003577259.1.954 XP_010237003.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]