SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G02100.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G02100.1
Domain Number 1 Region: 142-504
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.75e-30
Family WD40-repeat 0.0082
Further Details:      
 
Domain Number 2 Region: 469-711
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.27e-16
Family WD40-repeat 0.013
Further Details:      
 
Domain Number 3 Region: 11-107
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00000000706
Family YVTN repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G02100.1   Gene: BRADI4G02100   Transcript: BRADI4G02100.1
Sequence length 793
Comment pep:novel chromosome:Brachy1.0:4:1368036:1374298:-1 gene:BRADI4G02100 transcript:BRADI4G02100.1
Sequence
MITGGQSYVSAPPAFSADGRLLLVCSGRVVSVFSTSTGMLVSELEGHEGDVTAVVVAPPP
ANAAAAAMVASYCWTAGLDGMLIYWDFAAAELVRKVHVGLPVHSMVVPNITRTSKVTEVY
TPFAFVSVEDTSKSANEAKALRGQLRIYDLTKGRQVGSLLAETRKPPKIVASCSGEFLGI
VNKRKLYIWSIPTKDFKPDKIRKIKLGHTKNLNTLAFHPSERIVAGGDVTGRILIWRGFG
NAKFSKAHGAKSQADEERDGVRGEDDAETCTTWHWHSSGVKFLKFASDGAYLYSGGMEGV
IVVWQLDTGKRRYKPRLGSPLLFFVGSPDSSISCVSCTNNQIHLLKMPNMVVLKTIAGIK
LPLTSPNLVRRDVYGFDCTNGLVAVPTEDYCIQFYNLFENTEVSEVQVCERNFQPVDDIT
MYISLVSLSINGNFMCTVEVKLPEEELGGLVTLKFWNHGSRAGHFHLSTVIYEPHSDAAI
SAVAFRPGKNMAVSSSVGGNFKVWVQSLSLQSSDEKSQSGWRCQSVGSYKKKPMTAAAFS
GDGSVLAVAAESVITLWDPDNNALVGVIAEALSPITKLSFGGTSAYLMSLSQSSKPQVAV
WNVSNLSMQWSYTLFAEAACSSSKGEFAVLSLLSYPEGETPAEQDGVILLFNAENSNPIL
SWSVKKAKGGSLAFVKDDISLDARGEDASLLVYVNGSHEYFIFDPRKNEESQLSKSAQKN
IQADEPASIGYAAIYGQLPKLELKKEVSDVPFIPSERPWETIFTGSSHVLPPLTKLCSVF
LASLLEKRPVANE
Download sequence
Identical sequences I1IGK4
XP_003577564.1.954 15368.BRADI4G02100.1 EG:BRADI4G02100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]