SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G02547.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G02547.1
Domain Number 1 Region: 49-117
Classification Level Classification E-value
Superfamily F-box domain 0.000000746
Family F-box domain 0.018
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G02547.1
Domain Number - Region: 157-191,238-380,415-476
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00876
Family Galactose oxidase, central domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G02547.1   Gene: BRADI4G02547   Transcript: BRADI4G02547.1
Sequence length 598
Comment pep:novel chromosome:Brachy1.0:4:1806086:1810718:-1 gene:BRADI4G02547 transcript:BRADI4G02547.1
Sequence
MRSLFPSPVQPFLPFFSSERIKMDGPSMLQTYYDQGSMAGGGGHVDQTARLSGDEFAEIL
RRVPPRWLAASRCVSKSWRAAIDGHGLLRADLLPLSVAGLFFHLNQHIYPEFLSCPSSSV
SGRLDFLRHANPKFRGGRRIPDYRVLDQCNGLLLLPQWVVNPATGRWITLPPSPAKEEDP
RNRVWCYQRFLDYDPTVSPHLEVLMVPSLVNNDYYEEEEEENPLVAMGMAGLEWPPSPCK
MHVFSSRSGRWEERSFVREGDAAGTLGELRLGLSCCAAAHLRGTLYIHCLADSIMRISLA
DNTYRMIKTPVYAAGLKPYRLRIDMGRSENGVYFASLHNGCLRVWILKELCGGEVEWILK
HENDLKPIPSFSSTAGALAAAPVSGRLDLLCRANPKFFGDPDKFGHWWDDEAIDHYDYKI
HHHCNGLLLLEQWVVNPATGWWTALPPTPSPAMEDTKNDVWYYDRFLVYDPTCRRTSRSP
EPRPGRRAPPHWRGSPATATSSTAPPHKRKDLAASPPLLCSLSSAERPLSVVRLRRAAQP
PPSSAAALCSTAGDSVSIAPSTGPLLHSAGLQVSLPKPPLDSSSHLSTNTSIDFQFQL
Download sequence
Identical sequences I1IGR2
EG:BRADI4G02547.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]